KEGG   Flavobacterium psychrophilum JIP02/86: FP1010Help
Entry
FP1010            CDS       T00548                                 

Gene name
recG
Definition
(RefSeq) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:fps00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    FP1010 (recG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fps03400]
    FP1010 (recG)
Enzymes [BR:fps01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     FP1010 (recG)
DNA repair and recombination proteins [BR:fps03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     FP1010 (recG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C DEAD RecG_wedge ResIII tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 5300168
NCBI-ProteinID: YP_001295915
UniProt: A6GYD1
Position
complement(1188570..1190675)
Genome map
AA seq 701 aa AA seqDB search
MNNLFETPIEYLKGVGPQRGDLLRKELGVYKYGDLINFYPNRYLDRTKYYKISELQNSSA
EVQIIGKVIHIKSVEFAKGKSRLVATFIDDTGQMELVWFQGQKWVKESLKLNVVYVIFGK
TTSFNNTFNMAHPEMELLSEHEQSIRLAMQPVYPSTEKLTNRGISNKVVNKMMQQLFSET
HTLFSETLPIYLIEELKLISKKEALINIHFPKNAEALAKAQFRLKFEELFFIQLQLITKN
LIRKHKIKGFPFDKVGNYFTEFFNNHLPFNLTNAQKRVLKEIRNDMGNPAQMNRLLQGDV
GSGKTIVAFMSMLLALDNGFQACLMAPTEILANQHFIGLLELSKPLNINIKILTGSSNTK
ARKIIHEELENGSLHILIGTHALLEDKVQFKNLGLAIIDEQHRFGVEQRSKLWKKNTIPP
HVLVMTATPIPRTLAMSLYGDLDISVIDELPPGRKPIKTVHRFDSNRLKVWHFIREEIEK
GRQIYIVYPLIQESEKMDFKDLMDGYESLSRDFPLPKYAISILHGKMKPADKEAEMKRFS
DGKTNIMVATTVIEVGVNVPNASVMIIESAERFGLSQLHQLRGRVGRGADQSYCILMTSH
KIGEDSKTRMETMVATNDGFEIAEVDLKLRGPGDIMGKQQSGVLNLQIADLVRDKDILLL
ARNYALKLLKDDAPMEKPEHQTLRKVFIEISKKKNIWNYIS
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgaataacctcttcgaaaccccaatagaatacctaaaaggcgtgggtccacaacgcggg
gatttgttgcgcaaagaactgggggtttataaatacggcgatttaataaacttttatcca
aataggtatttagaccgaaccaaatattataaaataagtgaactgcaaaattctagtgcc
gaagttcaaattattggtaaagtaattcatataaaatcagtcgaatttgccaaaggaaaa
agccgattggtagccacttttatcgatgatactggccaaatggaattggtttggtttcaa
ggtcaaaaatgggttaaagaaagtttaaaacttaatgtggtttatgttatttttggaaaa
acgacttccttcaacaataccttcaacatggcacatccagaaatggaattgctaagcgaa
catgagcaaagcattcgtttggcgatgcaacccgtgtatccaagtaccgaaaaactgacc
aatagaggcatttcgaacaaggttgtaaataaaatgatgcaacaattattctcggaaaca
catactttgttttcagaaacattacccatttatttaatcgaagaattaaagctaatttct
aaaaaagaggctttaataaatattcattttccaaaaaatgcagaagctttggcgaaagcc
caatttcgattaaaatttgaagaattgttctttattcaattacaattaattactaaaaat
ttaattagaaaacacaaaataaaaggttttcctttcgataaagtaggaaactattttact
gaatttttcaataatcatttacctttcaatttaacaaatgctcaaaaaagagtactcaaa
gagattagaaatgacatgggaaatcctgctcaaatgaaccgattattgcaaggcgacgta
gggtcaggaaaaacaattgttgcttttatgagcatgcttttggctttagacaatggtttt
caagcttgtttaatggcacctacagaaattttagcaaaccaacattttattgggttatta
gaattatctaaaccacttaatatcaatataaaaatactaactggctctagtaatactaaa
gctagaaaaatcattcatgaagaactcgaaaacggaagtttacacattctaattggtaca
catgctttattagaagataaagtacaatttaaaaatttaggcctggcaattatcgatgag
caacatcgttttggtgtagagcaacgctctaaattatggaaaaaaaacaccattcctccg
cacgttttagtcatgactgctacgccaattcctagaactttagccatgagtttgtatggc
gatttagatatttcggtaattgatgagttaccaccaggcagaaagcctattaaaacagta
catcggtttgattccaaccgattaaaagtttggcattttattcgtgaagaaatcgaaaaa
gggcgccagatatacatcgtttatccattaatacaagaatctgaaaaaatggattttaaa
gatttgatggatggttatgaaagtctttctcgtgattttccacttccaaaatatgctatt
tctatccttcacggaaaaatgaaaccagccgataaggaagccgaaatgaaacgcttttcc
gatggaaaaactaacattatggtggctacaacagttatagaagtaggtgtaaatgtgcct
aatgccagcgtaatgattatagaaagtgccgaacgttttgggctctcgcaattgcatcag
ttgcgtggtcgtgtaggccgtggtgccgaccaaagttattgcatcttaatgacttcacac
aaaataggtgaagattctaaaaccagaatggaaaccatggtggcaaccaatgatggtttc
gaaattgccgaagtagatctaaaacttcgtggtcccggagatattatgggcaagcaacaa
agtggcgttttaaatcttcaaattgccgacttagtgcgtgataaagacatattattactc
gctcgaaattatgccctaaaactattaaaagatgatgctcctatggaaaaaccagaacat
caaaccctaaggaaggtatttatagaaatttctaagaaaaagaatatttggaattacatt
agctaa

DBGET integrated database retrieval system