KEGG   Flavobacterium psychrophilum JIP02/86: FP1012Help
Entry
FP1012            CDS       T00548                                 

Definition
(RefSeq) hypothetical protein
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc COXG
Motif
Other DBs
NCBI-GeneID: 5299110
NCBI-ProteinID: YP_001295917
UniProt: A6GYD3
Position
complement(1187057..1187527)
Genome map
AA seq 156 aa AA seqDB search
MKIYTLQSKQNLPITLQQAWDFLSDPKNLKAITPEYMGFIIKSGANKPMFAGQIIQYIVT
PILGIKTKWVTEITHVEDKKYFVDEQRFGPYALWHHKHFLREIPGGVEMEDIVDYKIPMG
ILGQLVHPFLVKPKLKEIFEYREKKLIELFGEFKPQ
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttatactttacagtcaaaacaaaacttaccaataaccttgcaacaagcatgg
gattttctttcagaccctaaaaacctaaaagcaataacaccagaatatatgggttttatc
ataaaatctggcgcaaataaacccatgtttgcaggacaaatcatacaatatattgtaacc
cccattttaggaataaaaacaaaatgggtgaccgaaattacccatgttgaagacaaaaaa
tattttgtcgacgaacagcgttttgggccatacgcactctggcatcacaaacatttctta
cgagaaattcctggtggtgtcgaaatggaagatattgtagactataaaatacccatggga
atattaggacaattagttcacccgtttttagtaaaaccaaaattgaaagaaatattcgaa
taccgagagaaaaaattaattgaactttttggcgaatttaaaccacaataa

DBGET integrated database retrieval system