KEGG   Flavobacterium psychrophilum JIP02/86: FP1030Help
Entry
FP1030            CDS       T00548                                 

Definition
(RefSeq) hypothetical protein
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDDEXK_3 Phage_endo_I Cas_Cas4
Motif
Other DBs
NCBI-GeneID: 5300336
NCBI-ProteinID: YP_001295935
UniProt: A6GYF1
Position
complement(1162381..1162779)
Genome map
AA seq 132 aa AA seqDB search
MKNFPHQELTKSLIGIYYDVYNELGYGFLEKVYHNAMQIELKKRGFEVENQKKLNVHYKN
EIVGEYIPDLIVNNSVIIELKCVEYMVEAHECQLLNYLKATDCEVGLLLNFGKDPQFIRK
IFTNEFKKHNKY
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttccgcatcaagaattaactaaatcgttaattggtatttattatgatgta
tataatgaattaggttacggatttcttgaaaaagtatatcacaatgcaatgcagatagaa
ttaaaaaaaagagggtttgaagttgaaaatcaaaaaaaattaaatgttcattataaaaat
gaaatcgttggagagtatattccagatttaatagtaaataattcagtaattattgagtta
aagtgtgttgagtatatggttgaagcccacgaatgtcaactattaaattatttaaaagca
acagattgtgaagtaggtttgttattaaactttggaaaagacccacagtttattagaaag
atttttacaaatgaatttaaaaaacataataagtattaa

DBGET integrated database retrieval system