KEGG   Flavobacterium psychrophilum JIP02/86: FP1046Help
Entry
FP1046            CDS       T00548                                 

Definition
(RefSeq) Hypothetical protein
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 7TM_GPCR_Srh DUF3169 7TM_GPCR_Srsx DUF4064 DUF4131 Tetraspannin E1-E2_ATPase DUF1751 Sigma_reg_N SNARE
Motif
Other DBs
NCBI-GeneID: 5298566
NCBI-ProteinID: YP_001295951
UniProt: A6GYG7
Position
complement(1145994..1146188)
Genome map
AA seq 64 aa AA seqDB search
MNKIINFISILIVGISIISFFISILYLIFDKKNRKKALQTLLASVILFIIGFSACVSTFD
LDVR
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaattattaattttattagtatcctaattgttggaataagtataatttcattt
ttcatatcaatactttatctaatttttgataaaaaaaatcgtaaaaaagctttacaaact
ctattagcatctgttatactttttatcatcggatttagcgcttgtgtatctacttttgat
ttagatgtgagatag

DBGET integrated database retrieval system