KEGG   Flavobacterium psychrophilum JIP02/86: FP1048Help
Entry
FP1048            CDS       T00548                                 

Gene name
tal
Definition
(RefSeq) Transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00030  Pentose phosphate pathway
fps01100  Metabolic pathways
fps01110  Biosynthesis of secondary metabolites
fps01120  Microbial metabolism in diverse environments
fps01130  Biosynthesis of antibiotics
fps01200  Carbon metabolism
fps01230  Biosynthesis of amino acids
Module
fps_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FP1048 (tal)
Enzymes [BR:fps01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     FP1048 (tal)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-GeneID: 5298568
NCBI-ProteinID: YP_001295953
UniProt: A6GYG9
Position
1143630..1144286
Genome map
AA seq 218 aa AA seqDB search
MKFFIDTANLAQIKEAQALGVLDGVTTNPSLMAKEGITGKNNILKHYVDICNIVEGDVSA
EVNAMDYDGMIREGEELAELHDQIVVKLPMTKEGIMACKYFSDRGIRTNVTLIFSAGQAL
LAAKAGATYCSPFIGRLDDISTDGLNLIQEIRDIYDNYGFETQILAASVRHTMHVVNCAK
IGADVMTGPLSSILGLLKHPLTDIGIAQFIADFEKGNR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttttatagacacagcaaatcttgcacaaataaaagaagcacaagcacttggt
gttcttgatggcgttacgacaaatccgtcgcttatggccaaagaaggaattacgggaaaa
aataacattttgaagcattatgttgatatttgtaatattgtagaaggtgatgttagtgcc
gaagtaaatgccatggattatgacggaatgattcgtgagggcgaagaattagctgaatta
cacgatcaaattgtggtaaaattgcctatgactaaagaaggaattatggcttgtaaatat
ttttctgataggggaattagaacaaatgttactttaattttctcggctggacaagcgctt
ttagcggcaaaagcgggggcaacttattgttcgccatttataggacgattagatgatatt
tctactgatggtttaaatttgattcaggaaattcgtgatatttatgacaattatggtttt
gaaacgcaaattcttgcagcatcagttaggcatactatgcatgtggttaattgtgccaaa
attggtgctgatgttatgactggacctttgtcatctattttaggtttgctaaaacatcct
ttgacagatattggaattgcacagtttattgccgattttgagaaaggaaatagatag

DBGET integrated database retrieval system