KEGG   Flavobacterium psychrophilum JIP02/86: FP1052Help
Entry
FP1052            CDS       T00548                                 

Definition
(RefSeq) Hypothetical protein
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2892 DUF3040
Motif
Other DBs
NCBI-GeneID: 5298581
NCBI-ProteinID: YP_001295957
UniProt: A6GYH3
Position
1140348..1140530
Genome map
AA seq 60 aa AA seqDB search
MGMNKNTILGWATLMMVVMGLVLIGLGAYRYADVAGWGFATVGLGFLLNAWVFSSLKGRL
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgggaatgaataaaaatacaattttaggttgggcaactttaatgatggtggtaatgggc
ttggtcttaataggtcttggtgcttaccgatatgccgatgtagcgggttggggttttgca
actgttggtttaggttttttgctaaatgcttgggttttcagctcattgaagggtaggctt
tag

DBGET integrated database retrieval system