KEGG   Flavobacterium psychrophilum JIP02/86: FP1061Help
Entry
FP1061            CDS       T00548                                 

Definition
(RefSeq) Probable methyltransferase
  KO
K07056  16S rRNA (cytidine1402-2'-O)-methyltransferase [EC:2.1.1.198]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Brite
KEGG Orthology (KO) [BR:fps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:fps03009]
    FP1061
Enzymes [BR:fps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.198  16S rRNA (cytidine1402-2'-O)-methyltransferase
     FP1061
Ribosome biogenesis [BR:fps03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    FP1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase DUF374
Motif
Other DBs
NCBI-GeneID: 5299957
NCBI-ProteinID: YP_001295966
UniProt: A6GYI2
Position
1133754..1134467
Genome map
AA seq 237 aa AA seqDB search
MGKLYLVPTPIGNLEDMTFRAIRVLKEVDLILAEDTRTSGKLLKHFEISTHMHSHHMHNE
HKTIENIIKRIQTGENIALISDAGTPAISDPGFLLTRACVENNIEVDCLPGATAFVPALV
NSGFPNDKFIFEGFLPEKKGRQTRYLALAEETRTMILYVSPHKLVKTLAEFVQYFGAERP
VSVSREISKLHEETIRGTAEEVLSHFEIKPPKGEIVVIVGGKIAAKEKKESKFDNED
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggggaaattatatctagttccaacaccaattggtaaccttgaagacatgacttttcgt
gccattagggtactaaaagaagtcgatttaattcttgccgaagacactcgtacaagcgga
aaactcttaaagcattttgagatttcgacccacatgcacagccatcacatgcacaacgag
cacaaaaccatcgagaatattataaaacgcatacaaactggcgaaaatattgctttaatt
tccgatgcaggaacaccagccatttcagacccaggatttttgctcacacgagcttgtgta
gaaaataatatagaagtagattgtttgccaggagcaacagcatttgtgcccgctctagta
aatagtggttttcctaatgataagtttatttttgaaggttttttgcccgaaaaaaaaggc
cgtcaaacccgttatttggctttagccgaagaaaccagaaccatgattttatatgtttcg
ccacacaaattagtaaaaacattagcagaatttgttcagtattttggagccgaaagacct
gtttctgtatctagagaaatctctaaacttcacgaagaaaccattcgaggtacagccgaa
gaagttttaagccattttgaaataaaaccaccaaaaggggaaattgtggttattgtgggc
ggaaaaattgctgcaaaagaaaaaaaagaaagtaaatttgataacgaggattaa

DBGET integrated database retrieval system