KEGG   Flavobacterium psychrophilum JIP02/86: FP1065Help
Entry
FP1065            CDS       T00548                                 

Gene name
mscL
Definition
(RefSeq) Large-conductance mechanosensitive channel
  KO
K03282  large conductance mechanosensitive channel
Organism
fps  Flavobacterium psychrophilum JIP02/86
Brite
KEGG Orthology (KO) [BR:fps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fps02000]
    FP1065 (mscL)
Transporters [BR:fps02000]
 Other Transporters
  Pores ion channels [TC:1]
   FP1065 (mscL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MscL Flavi_NS4A
Motif
Other DBs
NCBI-GeneID: 5299887
NCBI-ProteinID: YP_001295970
UniProt: A6GYI6
Position
complement(1129175..1129591)
Genome map
AA seq 138 aa AA seqDB search
MGFFADFKASLMKGDVLSLATAVVIGGAFGKIVGSAVDDIIMPIVGVLTGGVDFTTKFIA
LNGQSYADLAAAKTAGAACLTYGNLVQAIINFIIISFFIFVVLRAAEKAKKKEEAAPTAP
AGPSQEELLTQIRDLLKK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgggttttttcgcagattttaaagcatctttaatgaaaggtgacgtattaagtttagca
actgcggttgttattggtggggcatttgggaaaattgttggttcagcagttgatgatatt
attatgccaattgtaggagtattaacaggtggagtagattttacaactaaatttattgcc
ttaaacggacaaagctatgctgatttagcagcagcaaaaactgcaggagcagcttgttta
acatacggaaatttagtgcaagcaatcataaactttattattatttcgttcttcatattc
gtagttttaagagctgcagaaaaagcaaaaaagaaagaagaagcagctccaactgcacca
gcaggaccttcgcaagaagaattgcttacacaaattagagatttattaaaaaaataa

DBGET integrated database retrieval system