KEGG   Flavobacterium psychrophilum JIP02/86: FP1068Help
Entry
FP1068            CDS       T00548                                 

Gene name
ald
Definition
(RefSeq) Alanine dehydrogenase
  KO
K00259  alanine dehydrogenase [EC:1.4.1.1]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00250  Alanine, aspartate and glutamate metabolism
fps00430  Taurine and hypotaurine metabolism
fps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FP1068 (ald)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    FP1068 (ald)
Enzymes [BR:fps01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.1  alanine dehydrogenase
     FP1068 (ald)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AlaDh_PNT_C AlaDh_PNT_N Shikimate_DH 2-Hacid_dh_C F420_oxidored NAD_binding_7 TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 5298802
NCBI-ProteinID: YP_001295973
UniProt: A6GYI9
Position
complement(1125739..1126932)
Genome map
AA seq 397 aa AA seqDB search
MTITPFSKQDLLPQEEKLEIAKHKSELFIGIPKETSYQERRICLTPDAVNAMTAQGHRVL
IEAGAGENSSYSDKNYSDAGAEITNDTKKVLACPMILKVEPATLVEIEMMHPKTIIISAI
QLKTRKKEYFEALQKKKITALAFEYIKDEDGSFPAVKSLSEIAGTASVLVAAELLTASKF
GNGLLFGNITGVPPTEVVILGAGTVAEFAARTAIGLGASVKVFDNSITKLRRLQNNLNQR
IFTSTIQNKTLLKSLQRCDVAIGAIRGKYRAPIVVSQTMVEHMKKGSVIIDVSIDTGGCF
ETSEITTHENPTFIKNGIIHYCVPNIPSRYSKTASLSISNIITPYLLQIADDGGIESAIR
CDSGLKNGVYFYHGILTNKTIGEWFNLNHRDINLIVF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaattacaccttttagcaaacaagatttacttccacaagaagaaaaactagaaata
gctaagcacaagagcgaactttttattggtattccaaaagaaacctcctatcaggaacgc
agaatttgcctaacaccagatgccgtaaatgcaatgactgctcaaggtcatagggttttg
atagaagcaggagcaggagaaaattcgagttattccgacaagaattatagtgatgcagga
gcagaaataaccaacgatactaaaaaagttttggcttgtccgatgatcttaaaagtagag
cctgcaactttagttgaaatagaaatgatgcaccctaaaacgattatcatttcagcaatt
caactaaagactagaaagaaagaatattttgaagccctacagaagaaaaaaataaccgct
ttagctttcgaatacattaaagatgaagatgggtcatttccagctgtaaaatcgctaagc
gaaattgcaggaacagcatctgtgctagtggctgcagaattgctaacggcaagtaaattc
ggaaacggacttctttttggaaacataacaggcgtccctcctaccgaagttgtaattctg
ggtgctggaactgtggcagaatttgctgccagaaccgccataggattgggcgcaagtgtt
aaagtttttgataattcaataacaaaattacgccgtttgcaaaacaatttaaatcaaaga
atatttacttcaaccattcaaaataaaacgttactaaaatcattacaacgttgcgatgtt
gctattggcgcaataagaggaaaatatagagccccaattgtagtaagccaaaccatggta
gaacacatgaaaaagggctctgtgattattgatgtaagtatcgatacaggaggatgtttc
gaaacttcagaaattacgactcacgaaaaccctacattcataaaaaacggaattattcac
tattgcgtacccaatattccttctagatattccaaaacagcatcgttatctattagtaat
atcatcacaccatatttacttcaaattgcagatgatggtggaatagaaagtgctattcgt
tgcgattcaggtctaaaaaatggtgtttatttctaccacggaattttaaccaataaaact
attggcgaatggttcaatttgaatcatcgagatataaatttaattgtattttaa

DBGET integrated database retrieval system