KEGG   Flavobacterium psychrophilum JIP02/86: FP2408Help
Entry
FP2408            CDS       T00548                                 

Gene name
sucA
Definition
(RefSeq) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00020  Citrate cycle (TCA cycle)
fps00310  Lysine degradation
fps00380  Tryptophan metabolism
fps01100  Metabolic pathways
fps01110  Biosynthesis of secondary metabolites
fps01120  Microbial metabolism in diverse environments
fps01130  Biosynthesis of antibiotics
fps01200  Carbon metabolism
Module
fps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FP2408 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    FP2408 (sucA)
   00380 Tryptophan metabolism
    FP2408 (sucA)
Enzymes [BR:fps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     FP2408 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PhaC_N
Motif
Other DBs
NCBI-GeneID: 5299160
NCBI-ProteinID: YP_001297263
UniProt: A6H288
Position
2762443..2765214
Genome map
AA seq 923 aa AA seqDB search
MDRFSFLNAAHTEFFAQLYDQYLENPDSIEPSWRSFFQGFDFGMTTYSEENAANQMANIA
TTNVDNGQVSDKILKEFNVLKLIDGYRTRGHLFTQTNPVRERRHYTPTLELSDFGLTDSD
LNTVFDAAKIIGHQPSTLQEIIIHLKNVYCQHIGIEYMYMRNPEIIQWVQNKINTNDNQP
NFDNNQKKIILEKLNEAVSFENFLHTKYVGQKRFSLEGGETIIAGLDALIEAAADKGVEK
FVMGMAHRGRLNVLANIFKKSTQDIFSEFDGKDYDQEYFDGDVKYHLGLTSDRKTRSGKN
ININLAPNPSHLETVGAVIEGITRAKQDKYFPNDFSKVLPIAVHGDAAIAGQGILYEIIQ
MAQLDGYKTGGTIHIVINNQVGFTTNYLDARSSTYCTDIAKVTLSPVLHVNADDAEAVVH
AMLFALDFRMQFGRDVFIDLLGYRKYGHNEGDEPRFTQPLLYKIIAKHKNPRDIYAEKLL
AQNIIDGNFVKELETSYKQDLDDNLEASRKKSLTVITPFMQNEWEGFVQVSDDVMLQKVN
TKFDKKELDSIIETISTLPSDKKFINKISKIVNDRKTMYDNNTIDWGTAETLAYGSLLTE
GYDVRISGQDVERGTFSHRHAVVKVEDSEEEVVLLNDIKGKKGNFNVFNSHLSEYGVLGF
DYGYALANPNALTIWEAQFGDFSNGAQIMIDQYISCGEDKWNNQNGIVMLLPHGYEGQGA
EHSSGRMERYLQLCARHNMVVADCTTPANFFHLLRRQMLTKYRKPLIVFTPKSLLRDPRC
VSTQDEIANGEFQETIDDISVNKTQVKTLVFCTGKFYYDITAERENLQRNDVAVVRIEQM
FPLPVEQLKAIVASYPNADDYVWAQEEPKNMGAYSFMLMNFDFIKWRLASLKAYAAPAAG
SYTRAKRRHADAIRMVFDKDLFR
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggataggttttcatttttaaacgcagctcacacagaatttttcgcacaattatacgac
caatatctcgaaaatccagatagtatcgagccttcttggaggagtttctttcagggtttc
gattttggaatgacaacttatagcgaagaaaacgcagcaaatcagatggcgaatatcgct
acaacaaatgtagataacggtcaagtttcagataaaattctaaaagaatttaatgtattg
aaactaatagatggttatagaactcgtgggcatttatttacccaaaccaaccctgttcgt
gagcgaagacattacacgccaacattagaactgtcagattttggtcttaccgattccgat
ttgaatactgtcttcgatgcagcaaaaataattggacaccagccatcaaccttacaagaa
ataattattcacctcaaaaacgtatattgccaacatattggtatcgaatatatgtatatg
agaaatcctgaaatcattcaatgggttcagaacaaaataaacacaaacgacaatcagcct
aattttgataacaatcagaaaaaaattatcctcgaaaaactaaatgaagctgtttcgttc
gaaaactttttacatactaaatatgtaggtcaaaaacgattttcattagaaggaggagaa
actataattgctggtttagacgctcttatagaagccgccgctgataaaggtgtcgaaaaa
tttgtaatgggaatggcacaccgtggccgtttaaacgttttagcaaatatttttaaaaaa
tcaacacaagatatcttctcggaatttgacggaaaagattacgaccaagaatatttcgat
ggtgatgtaaaataccatttgggtttaacctccgataggaaaacacgatcaggaaaaaac
atcaatatcaatttagccccaaacccttcacacctagaaactgttggagctgttattgaa
ggaattactcgtgccaaacaagacaaatattttcctaacgatttctcgaaagtattgcct
atcgccgttcacggtgatgccgcaattgcaggacaaggaatcctatacgaaattatccag
atggcacaactagacggttacaaaactggcggaactattcatatagtgattaacaatcaa
gttggttttacaactaattatcttgatgcacgctcatcaacttattgtaccgatattgca
aaagtaacactatcaccagtattacacgtaaatgcagatgatgccgaagctgttgtacac
gccatgctttttgctctagatttcagaatgcaatttggtcgtgacgtatttatagattta
ttaggatacagaaaatatggtcataacgaaggcgacgaacctcgttttacacaaccatta
ttatacaaaatcattgcaaaacacaaaaacccacgtgatatttatgccgaaaaattatta
gcacaaaacatcatcgatggcaattttgtaaaagaattagaaacatcatacaaacaagat
ttagatgacaatctagaagcatcacgtaaaaaatcactcacagtaatcacgccatttatg
caaaatgaatgggaaggatttgtgcaggtttcagatgacgtaatgcttcaaaaagtaaat
acaaaatttgataaaaaagaattagattctatcatagaaaccatttcgacattgccatcg
gacaagaaatttatcaataaaatttctaaaattgtcaatgacagaaaaacgatgtacgac
aacaacaccatcgactggggaactgccgaaaccttggcctatggttcgctactaacagaa
ggttacgatgttcgtatctcaggacaagatgtagaaagaggaacattctcacaccgtcac
gccgttgtaaaagtagaagatagcgaagaagaagttgttttattaaacgatataaaaggg
aaaaaaggaaacttcaatgttttcaattcacacctttcagaatacggagtcttaggattc
gattacggatatgcactagcaaacccaaatgctttaaccatttgggaagcacaatttggc
gatttcagtaatggagcccaaattatgatagaccaatacatttcgtgcggagaagacaaa
tggaacaaccaaaacggtatcgtaatgttgttgcctcacggatacgaagggcaaggagca
gaacactcctcaggaagaatggaacgctacttacaactttgtgcacgccataatatggtt
gttgccgattgtacaacacccgccaatttcttccacctactaagaagacaaatgcttaca
aaataccgcaaaccattaattgtgtttaccccaaaaagtttgcttcgtgatcctagatgt
gtctctacacaagacgaaatcgcaaatggtgagtttcaagaaactatcgatgatatttca
gtaaataaaacccaggttaaaacattagttttctgtacaggaaaattctattacgacatt
actgccgaaagagaaaacctacaaagaaacgatgttgcagtggtaagaatcgaacaaatg
ttcccgttaccagtagaacaattaaaagcaattgtggcaagctatccaaatgcagatgat
tatgtttgggcacaagaagaacctaaaaacatgggagcttatagttttatgctaatgaat
ttcgatttcataaaatggagattggcatcgttaaaagcatacgccgcaccagcagcagga
agttataccagagcaaaacgccgtcacgccgatgcaattagaatggttttcgacaaagat
ttgtttagataa

DBGET integrated database retrieval system