KEGG   Flavobacterium psychrophilum JIP02/86: FP2409Help
Entry
FP2409            CDS       T00548                                 

Gene name
sucB
Definition
(RefSeq) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00020  Citrate cycle (TCA cycle)
fps00310  Lysine degradation
fps01100  Metabolic pathways
fps01110  Biosynthesis of secondary metabolites
fps01120  Microbial metabolism in diverse environments
fps01130  Biosynthesis of antibiotics
fps01200  Carbon metabolism
Module
fps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FP2409 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    FP2409 (sucB)
Enzymes [BR:fps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FP2409 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N QRPTase_N
Motif
Other DBs
NCBI-GeneID: 5300594
NCBI-ProteinID: YP_001297264
UniProt: A6H289
Position
2765389..2766600
Genome map
AA seq 403 aa AA seqDB search
MILEMKVPSPGESIKEVEIATWLVKDGDYVEKDQAIAEVDSDKATLELPAEASGIITLKA
EEGDAVAVGAVVCHIDTDGEKPSGSAPVAEAPKAEVKVEAPKVAPVAQKTYAAQTPSPAA
RKILDEKNIQPSDVVGTGKGGRITTEDAVNAVPSMGTPTGGSRGSERTKLSMLRRKVAER
LVAAKNETAMLTTFNEVNMTPINNIRNQYKDAFKAKHNGVGLGYMSFFTKAVTRALQLFP
DVNSMMDGDYKVAYDFADISIAVSGPKGLMVPVVRNAELLTFRGVEAEIKRLAIRARDGQ
ITVDDMTGGTFTITNGGVFGSMLSTPIINPPQSGILGMHNIIERPIAVNGQVEIHPMMYV
ALSYDHRIIDGRESVGFLVAVKEALENPLELLLDNNPKKAFEL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaatgaaagtcccatcaccaggggaatcaatcaaagaagttgaaatcgca
acttggttagtaaaagatggcgattatgtagaaaaagaccaagccattgccgaagtcgat
tcagacaaagcaacactagaattacccgcagaagcaagtggaatcattacactaaaagcc
gaagaaggtgatgccgttgccgttggcgctgtagtttgtcatattgatactgatggcgaa
aaaccatctggatctgctcccgttgccgaagccccaaaggcagaagtaaaagtagaagct
ccaaaagttgctccagtagctcaaaaaacctatgctgcacaaacaccttcccctgccgct
agaaagatattagacgaaaaaaacatacaaccatcagatgttgtaggaacaggaaaaggc
ggaagaattactaccgaagatgctgtaaatgcagtgccttctatgggaacgccaactggt
ggatctcgtggttcggaacgcacaaaactatctatgttgcgccgtaaagttgccgaaaga
ttagtcgctgctaaaaatgaaaccgctatgttaactacgttcaacgaagtaaacatgaca
ccaataaataacattcgtaaccaatacaaagacgcattcaaagcaaaacacaatggtgtt
ggtttaggttacatgtctttctttaccaaagccgtaactcgtgctttacaactttttcca
gatgttaactcgatgatggacggagattataaagtagcttacgattttgcagatatttct
atcgcagtttctggaccaaaaggattaatggttcctgtagttagaaatgcagaattatta
acttttcgtggtgttgaagccgaaattaaacgtttggcaattcgtgctcgtgacggacaa
atcactgttgatgacatgacgggtggaacatttaccattaccaatggtggtgtttttgga
agtatgttatctacaccaattatcaatccgccacaatctggaattttaggaatgcacaac
attatcgaacgtcctattgctgtaaatggtcaagtagaaattcacccaatgatgtacgta
gcactttcttatgatcaccgtattattgatggtcgtgagtcagttggtttcttagtagct
gtaaaagaagctttagaaaacccattagaattgcttttagataacaatcctaagaaagca
ttcgaattgtaa

DBGET integrated database retrieval system