KEGG   Flavobacterium psychrophilum JIP02/86: FP2543Help
Entry
FP2543            CDS       T00548                                 

Definition
(RefSeq) Transposase IS1 family
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_23 Terminase_5 Sigma70_r4_2 HTH_28 HTH_38 Zn_Tnp_IS1595 Zn_Tnp_IS1 HTH_29 HTH_3 RNA_POL_M_15KD zinc-ribbons_6 Nudix_N_2 MerR_1 IBR DUF746 zf-SNAP50_C HTH_Tnp_1 Phage_terminase HTH_40 Metallothio_Pro zf-Dof
Motif
Other DBs
NCBI-GeneID: 16215758
NCBI-ProteinID: YP_008057922
UniProt: R7RVC8
Position
1171304..1171723
Genome map
AA seq 139 aa AA seqDB search
MEILACPKCQNNVIIKSGVINNKQRYLCKKCNYYFTVNKLGKKIDDYYVVKALQLYLEGL
SYREIERIIGVSHVTVSNWVKEYRIKKKSQGNYHPTYKILNHLELVEYIKNKDLLSGAGM
IITELGDKFMLMKWKRFKD
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggagattttagcttgcccaaaatgccaaaacaatgtgattataaaaagcggtgtgatt
aataataaacaaaggtatttatgcaaaaaatgcaattattattttacagtaaataaacta
ggtaaaaagattgatgattattatgttgttaaagctttacagctttatttagaagggctt
agttatcgagaaatagaacgcattattggggtttcgcatgttacggtaagtaactgggta
aaagagtatagaataaaaaaaaaatcgcagggtaattaccatcctacttataaaatattg
aatcatttagagctggtagaatatattaaaaataaggatttattatctggtgcaggaatg
attataaccgagcttggcgataagtttatgcttatgaaatggaaacgttttaaagattaa

DBGET integrated database retrieval system