KEGG   Flavobacterium psychrophilum Z2: AMR72_03865Help
Entry
AMR72_03865       CDS       T04556                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
fpsz  Flavobacterium psychrophilum Z2
Pathway
fpsz00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:fpsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AMR72_03865
Enzymes [BR:fpsz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AMR72_03865
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AMR72_03865
    1.1.1.-  
     AMR72_03865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C TrkA_N NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ALM48106
UniProt: A0A0P0U7A4
Position
complement(915567..916631)
Genome map
AA seq 354 aa AA seqDB search
MSNTMKAARWHAAKDIRVEETEIPTAGQKQVKIEVQFTGICGSDLHEYTHGPMLIPVDKP
YSLNGHQGVTTLGHEFSGIVSEVGEGVTNVKVGDRVVIEPLFKNPESPFIANGEYNLSEP
LGFVGLTSNGGFAKYTVVEDYMVHKIPDSMSFEQGALVEPAAVAVYGVLQSGLKLGQSCV
IFGAGPIGLLCVQAAIAAGSPNVIVVDVADKRLEKATEVGATHVINGKTEDIPGQVKKLT
NGGADVYLDAAGVQATYENGLKSLRNGGTAVLVALFGKPVTHDAFDQVVREITIKGIIAY
RNIFPQVIALIDSGRMPVEKLVTQKIKLDNIVADGFEALVSNPSQVKILVDING
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatacaatgaaggcggcacgctggcatgctgcaaaagatattagggttgaagaa
acagaaattcctacagcaggacaaaaacaggtaaaaatagaggttcagtttaccggtata
tgcggatctgatttacatgagtatacacacgggccaatgctgattccggttgataaaccg
tattcgcttaacgggcatcagggggttacaacacttggtcatgaattctcgggtatagtt
agcgaagttggtgaaggtgttacaaacgtaaaagtaggcgacagggtagtgatagagcca
ctgtttaaaaatcctgaaagcccatttattgctaacggagaatacaacctttctgagccc
cttggctttgtggggttaacatctaatggtggctttgcgaaatatacggtggtggaagat
tatatggtgcacaagattccggatagcatgagttttgagcagggtgcgcttgtagaacct
gctgcggttgcagtatatggtgttttacaaagcggattgaagctgggtcagtcatgcgta
atatttggtgcggggccaatcgggttattgtgtgtacaggcggctattgctgccggatcg
cccaatgttattgtggtagatgttgccgataaacgccttgaaaaagcaactgaagttggt
gcgacccatgttattaatggcaaaacagaagatattccgggacaggttaaaaaactaacc
aatggcggtgcagatgtgtatcttgatgctgccggagttcaagcaacatatgagaacggc
ctaaaaagccttagaaacggcggaacagctgtcttagtagcattatttggtaaacctgtt
acccacgatgcattcgatcaggtggtgagggaaattactattaagggtattattgcctac
aggaatatctttccgcaggttatcgcccttatcgattcgggacgtatgcctgtagaaaaa
ctggttacccagaaaattaaactggataatattgttgcagatggctttgaagctctggtt
tctaatccatcgcaggtaaaaatacttgttgatattaacggataa

DBGET integrated database retrieval system