KEGG   Flavobacterium psychrophilum Z2: AMR72_03880Help
Entry
AMR72_03880       CDS       T04556                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
fpsz  Flavobacterium psychrophilum Z2
Brite
KEGG Orthology (KO) [BR:fpsz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AMR72_03880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF1279 Col_cuticle_N
Motif
Other DBs
NCBI-ProteinID: ALM48109
UniProt: A0A0P0U703
Position
complement(919359..920423)
Genome map
AA seq 354 aa AA seqDB search
MFTLLVVIIILALIFDYINGFHDAANSIATIVATKVLTPFQAVLWAAFFNFLAYFISKYW
IGEFKIGNTIAKTVGEDFITLEVIFAGLIAAITWNLLTWKLGIPSSSSHTLIGGFMGAAM
AHAFTIPGADLNTVINYAKVIPIVLFIFAAPLIGMVVAYFLTILILNICRKANPSKADKW
FKRLQLISSALFSLGHGANDAQKVMGIIGAAVIYYHTKIDIDTAYLTAADPFKYFVEHYG
WVPLVSFAMIGLGTMSGGWKIVKTMGSKITKVTSLEGVTAETAGAITLYTAEHFGIPVST
THTITGSIIGVGITKRVSAVRWGVTISLLWAWILTIPVSAVIAAIMYYIVSLFT
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtttacattacttgtagtaattattattttagcattaatctttgattacatcaacgga
tttcacgatgctgcaaactctatagctaccatagttgctacgaaagtattaacgcctttt
caggcggtactttgggcagctttttttaactttcttgcttattttatttctaaatactgg
attggagagtttaaaattggtaacacgatcgctaaaactgttggcgaagattttataaca
cttgaggttatttttgcaggacttattgcggctatcacctggaaccttttaacctggaaa
ctaggtataccatcgtcatcatcgcatacacttatcggtggttttatgggtgctgctatg
gctcatgctttcacaattcccggtgcagatcttaatactgttattaattacgcaaaagta
attcctatcgtattatttatttttgctgctcctttaattggtatggtcgtcgcatatttt
cttactatacttatactcaatatttgccgtaaagcaaacccgtctaaagctgataagtgg
tttaaaaggcttcaattgatttcatctgcactatttagtcttgggcatggtgctaacgat
gcgcaaaaggtaatgggtattattggtgcagcagttatctactatcatactaagattgac
attgatacggcttacttaactgctgcagatccgtttaaatattttgttgagcattatgga
tgggtgcctcttgtgagttttgctatgataggccttggtacaatgagcggtggctggaag
attgtgaaaactatgggatctaaaattacaaaagttacatcgcttgaaggtgtaacagcc
gaaacagcaggtgcaattacactttatactgccgaacattttggtattccggtatctaca
acacatactattacaggttcaattattggtgttggtatcactaaaagggtatcagcggta
cgttggggggtaactatcagccttctttgggcatggatacttacaataccggtatcagca
gtaattgcagcaatcatgtactatatcgtttctctatttacataa

DBGET integrated database retrieval system