KEGG   Flavobacterium psychrophilum Z2: AMR72_06550Help
Entry
AMR72_06550       CDS       T04556                                 

Definition
(GenBank) cytochrome C peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
fpsz  Flavobacterium psychrophilum Z2
Brite
KEGG Orthology (KO) [BR:fpsz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AMR72_06550
Enzymes [BR:fpsz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     AMR72_06550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 zf-C2H2_10 SH3_5
Motif
Other DBs
NCBI-ProteinID: ALM48582
Position
complement(1504926..1505969)
Genome map
AA seq 347 aa AA seqDB search
MRKIILMMVSSLLLLSCNKEEEYQEINEQLVFTVPANFPPMVQDLSLNHPTQKGFELGRR
LFYDANLSADGTVSCSFCHEQGYAFTHHGHALSHGIRDQEGTRNAPAVQNLMFMGEYFYD
GASDNIEMLSIVPIHNPLEMDETLENIALKLQKDKTYVQMFKKAFNGADITSGNILKALG
QFMTMMVSANSRYDKYVRNEPGGSLSVQELQGMELFAQKCASCHATDLFTDNSYRNNGLP
ANPLLNDYGRQNVTGFGYDRYKFKVPSLRNAELTAPYMHDGRFGSLESVLNFYASGVKDS
ETLDTLLHQNAVLGIALSADEKTAIIAFIKTLTDEDFIKNPLFYYKT
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattattctaatgatggtatcgtcattactattgttatcatgcaataaagag
gaagaataccaggaaattaacgaacaacttgtatttacagtacctgccaattttccacca
atggtacaggatttatccttaaatcatccaactcaaaaaggttttgaactaggaaggaga
ctgttttatgatgccaatctttcggctgacggaaccgtatcatgttcgttttgccatgag
cagggctatgcatttacccatcatgggcatgcgttaagccacggtatacgcgatcaggag
ggaacacgtaacgccccggcggtacaaaaccttatgtttatgggcgaatacttttatgat
ggagcatctgataacatagagatgctatctatagtgcctattcataatccgcttgagatg
gacgaaacacttgaaaacatagcgcttaagctgcagaaagataaaacttatgtgcagatg
tttaaaaaggcttttaatggtgccgatattacatccggaaatatcttaaaagcattaggg
caattcatgactatgatggtgtcggcaaattcgcgatatgacaagtatgtccgtaacgaa
ccgggaggcagtttgtctgtacaggaattgcagggcatggaactttttgcacaaaaatgt
gcttcgtgccacgcaactgatttgtttactgataattcctaccgcaataacggactgccg
gctaatccgctgctcaatgattacggacgccaaaacgtaacaggttttggttacgatcgc
tataagtttaaagtgccgagccttcgcaatgcagaattaacagcaccttacatgcacgat
ggacgcttcgggagtctggagtctgtgcttaatttttatgcatcaggagtaaaagactct
gaaacgttagatactttgctgcatcaaaacgcagttttaggtattgcactttcggcagac
gaaaaaacggctattatcgcttttataaaaacgcttactgatgaggacttcatcaaaaac
cccttattctattacaaaacataa

DBGET integrated database retrieval system