KEGG   Francisella philomiragia subsp. philomiragia ATCC 25015 O#319L: BZ13_763Help
Entry
BZ13_763          CDS       T03764                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
fpt  Francisella philomiragia subsp. philomiragia ATCC 25015 O#319L
Pathway
fpt00020  Citrate cycle (TCA cycle)
fpt00480  Glutathione metabolism
fpt01100  Metabolic pathways
fpt01110  Biosynthesis of secondary metabolites
fpt01120  Microbial metabolism in diverse environments
fpt01200  Carbon metabolism
fpt01210  2-Oxocarboxylic acid metabolism
fpt01230  Biosynthesis of amino acids
Module
fpt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpt_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:fpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BZ13_763
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BZ13_763
Enzymes [BR:fpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BZ13_763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AJI74746
UniProt: A0A0B6EU02
Position
complement(745844..748060)
Genome map
AA seq 738 aa AA seqDB search
MHKIFYTFTDEAPALATGSFLPIVESFTKVADIELETKDISLAARILANFSDYLTDEQKC
SDDLAILGELAKTPDANIIKLPNISASIPQLTSAIKELQSKGYKIPDYPFEPKDDKEQDI
KARYAKVLGSAVNPVLREGNSDRRVADAVKKYAEKHPHSMGAWTKDSKSHVASMADNDFY
ANEKSYIVPKATKVKIVHTDTKGTQTVLKDNLALEEKEIIDATKISIKALREFYKTEIAK
AKKEGTLLSLHLKATMMKVSDPILFGHAVEIFFEDVFKKYAKEFKELGVNPRNGWGDAVE
KIKQLPQDVQDKINADIEKVFAKQPDIAMVNSDKGITNLNVPSDVIVDASMPAAIRSSGQ
MWNKDGKLQDMKAMIPDRCYAGVYAATIDFCKENGAFDVTTMGDVSNVGLMAKKAEEYGS
HDKTFEIQADGKVEVIDAEGNVIFEHSVEKGDIWRACQTKDIAVKDWVKLAVNRARITQN
PAIFWLDSKRAHDRNLIAKVNEYLTLHDTTGLDIQILSPVEATKYSLKRMKEGKNTISVT
GNVLRDYLTDLFPILELGTSAKMLSIVPLLAGGGLFETGAGGSAPKHVEQLIEENHLRWD
SLGEFLALGASLEDLAIKTRDAKIKVLAEALSQANQDFLDNDKSPKRKVGELDTRGSHFY
LAYYWVKALAEQTGNAEIKAKFEPIYAELKANEDKIVKELNDAQGKKVDLGGYYFMDSDK
LAKVMRPSKTLNSILAKL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatattttatacattcacagatgaggcaccagctttagctactggttcattt
ttaccaatagttgaaagcttcactaaagttgcagatatcgagttagaaacaaaagatata
tcattagcagcacgtatattagctaacttcagtgattatcttacagatgagcaaaaatgc
tctgatgatttggcaatacttggagaattagcaaaaactcccgatgctaatattatcaaa
cttccaaatattagcgcatcaatccctcaacttacatctgctatcaaggagcttcagtca
aaaggttataaaatccctgattatccatttgagccaaaagatgataaagaacaggatatt
aaggctcgctatgcaaaagttttaggtagtgcggtaaaccctgtcttaagagaaggtaac
tcggatcgtagagttgcagatgcagttaaaaagtacgctgaaaaacatccacactctatg
ggagcatggacaaaagattctaaatctcatgttgctagtatggcagataatgatttttat
gctaatgagaaatcttatattgtgccaaaagcaactaaggttaagatagttcatacagat
actaaaggtactcaaacagtacttaaagataatcttgctttagaagaaaaagaaattatt
gatgctactaagatttcaataaaagcattaagagagttctacaaaactgaaatcgctaaa
gctaaaaaagaaggtacactactatcacttcatttaaaagctacaatgatgaaagtttca
gatccaatattattcggtcatgcagtagagattttctttgaagatgttttcaaaaagtat
gctaaagaatttaaagagcttggtgtgaatcctcgcaatggttggggtgatgcagtagaa
aagattaagcaactacctcaagatgtccaagataaaatcaatgctgatattgaaaaggtg
tttgctaagcagcctgatattgcgatggttaactctgacaaaggtattacaaacctaaat
gtcccaagtgatgttattgtagatgcttctatgcctgcagctattcgctcatctggtcaa
atgtggaacaaagatggcaagcttcaagatatgaaagctatgattcctgatagatgttat
gcaggtgtatatgccgcaactattgatttctgtaaagaaaatggtgcttttgatgttact
actatgggcgatgtttctaacgttggtttgatggcaaaaaaagcagaagaatatggttct
catgataagacatttgagattcaagcagatggtaaagttgaagttattgatgcagaaggt
aatgtgatatttgagcatagtgttgagaaaggcgatatttggagagcgtgccaaactaaa
gatatcgctgttaaagactgggttaagctagctgttaatagagctagaattactcaaaat
cctgcgattttttggttagattcaaaaagagcgcatgatagaaacttaattgctaaagtt
aatgaatatctgactttacatgatactactggtctagatatccaaattttatctccagta
gaggctacgaagtattctctaaagagaatgaaagaaggtaaaaacacgatttctgtaact
ggtaacgttttgagagattacttgacagatttattccctatcttagaacttggtacttct
gctaagatgctttctatcgtgcctcttttagctggtggtggattatttgaaactggagct
ggtggttctgcacctaagcacgttgaacaacttattgaagaaaaccacttaagatgggat
tctttaggagagtttttggcgttaggtgcttcattagaggatctagcaatcaaaactaga
gacgctaaaatcaaagtcttagcagaggcattatctcaagcaaaccaagatttcttggat
aatgataaatcaccaaaacgtaaggtaggtgagttagatactagaggaagtcatttctat
ttggcttattattgggtcaaagctttggctgagcaaactggtaatgctgaaatcaaagct
aaatttgaaccaatttatgctgagctaaaagctaatgaagataaaattgttaaagaactt
aacgatgcccaaggtaaaaaagtagatcttggtggttactactttatggatagtgataag
ctagcaaaagtaatgagaccaagcaaaactctaaactcaattttagctaagctataa

DBGET integrated database retrieval system