KEGG   Fusarium pseudograminearum: FPSE_00290Help
Entry
FPSE_00290        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
fpu  Fusarium pseudograminearum
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fpu01002]
    FPSE_00290
Enzymes [BR:fpu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     FPSE_00290
Peptidases [BR:fpu01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   FPSE_00290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 20358910
NCBI-ProteinID: XP_009251685
UniProt: K3W3L4
Position
1
AA seq 671 aa AA seqDB search
MDVITVPKPPPCQLPVAQVFDRLSSRQQLYAHYLSRASWHGSRIIMRGDWNNLADENAVN
ADQISAFLEYAGHFLYNMGNYWSEGDQKFIPDLSHEALRKLVRASRSPTAPDLLERVIEP
MLSGPPYVLGYPSERAQSAYYPGDEKISKEEISSVSKAMEEHKIEPENTRLQKVMVAGRA
EFRILQASTDNFPKKHLCDINGLGSIYIQSGDHVAELGQVCDALNKAKDYTENDIQRQVI
EHYLESFKTGTMESFRDAQKSWVQDKGPVVESIMGFVEPYRDPHGVRGEWEGFVGISDPV
ESHKMRQFVDQSTTFIRLLPWAVSDVNDGKGPFEKHVFVAPDYTNSHSLVFCASYSFEAT
NVPNYNDIRETCGFKNIVVANRMNASNDLTRPCHYVHDSEAKRYRECTYIVRFVTTAIHE
LLGHGSGKLLSETKPGQFNFDRKYPPVSPLTNKPITTWYRSGQTWTSTFGAAAPSIEECR
AMLVPLYLIDDKQLLSIFGYNETSDITTQDLHYNTYLQIGVEGLQGLAYYNVDERTWGQA
LKRAHWAILHHLLLDGDGVLAVEYGAQEGTLTVRVDKSKLLSHGKPSLGRFLCRIHIWRC
TADVSPCLEYYDKVTAVPGDHEEWRELVAKKPEPRWKFIHANTFLKDGNVTVKEYENSNE
GLIQSWVERGI
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcatcactgtacccaagccgcccccatgccagctgcccgttgctcaagtcttt
gaccgcctttcaagtcgtcaacagctttatgcccactacctatctcgggcctcctggcat
ggcagcagaattatcatgcgcggagactggaacaatctggctgacgaaaacgctgtgaat
gcggatcaaatctctgctttcttggaatatgccggccatttcttgtataacatgggcaac
tactggagcgagggcgaccagaagttcatccctgatctgtcgcatgaagcactccgaaag
cttgtcagggcctcccggtccccaacagctccggatctactagagagagtcatcgaaccg
atgctttcgggaccaccatacgtattgggatatcccagcgagcgagcacagtcggcttat
tacccaggagatgaaaagatcagcaaggaggaaatatcctcagtctccaaggcaatggaa
gagcacaagattgagccagaaaacaccaggcttcaaaaggtaatggtagctggcagagca
gagttccgaatcctccaagcttcgacggataactttcccaagaagcacttgtgtgacatc
aatggtcttggctctatctacattcaaagtggggaccatgttgctgaacttggtcaagtt
tgcgacgctcttaataaggccaaagactatactgagaacgacatccaacgtcaagtgatc
gaacattatctcgagagcttcaagactgggactatggaatccttcagagacgcccaaaag
tcatgggtccaggacaaagggccggttgtcgagagcatcatgggatttgtagagccatat
cgtgatccacatggcgtccgtggtgagtgggaaggcttcgttggtatttctgatcctgtt
gaatcccacaagatgagacagttcgttgatcaatctaccaccttcatcagacttttgcct
tgggcggtttctgatgtcaacgatggcaaaggtccattcgagaagcacgtattcgttgcc
cccgattacaccaacagccattcactagtcttttgcgcaagctattcattcgaggccacg
aatgtacccaactataacgacatcagagagacttgcggcttcaagaacatcgtcgtcgca
aaccgtatgaacgccagcaacgacctaacccgcccctgccattatgtgcatgattccgag
gccaagcgataccgggagtgcacgtacattgtcagatttgtaactacagcaatccatgaa
cttctgggtcacgggagtggcaaactcttgagtgagaccaagcctgggcagttcaacttt
gaccgaaaatatccgcctgtcagccctttgaccaacaagccgatcacgacatggtatcgc
tctggacaaacgtggacttctacctttggtgccgccgctcccagcattgaagagtgtcgg
gccatgttggttccgttgtatcttatcgatgataagcagctactttctattttcggatac
aacgaaacctcagatatcactactcaagatcttcattacaacacctatctccagattgga
gttgaaggtcttcaaggtcttgcctattacaatgtcgacgaaagaacctggggacaagca
cttaagagggcccactgggcaatcctccaccatcttctacttgatggggacggcgtcttg
gccgttgagtatggtgcccaagaaggaaccctcacagtcagggtcgacaaaagcaagttg
ctgtctcatggtaaaccctctttagggcgtttcctttgtcgcattcatatttggagatgc
actgcggatgtcagcccttgtcttgaatactatgacaaggttactgccgtgcccggcgat
catgaggaatggcgtgagctcgttgccaagaagccggagcctcgttggaagtttattcac
gcaaatacgttcttgaaggatgggaatgtcactgtgaaggagtatgagaacagcaacgaa
ggactgattcagtcatgggtggaaaggggtatttga

DBGET integrated database retrieval system