KEGG   Fusarium pseudograminearum: FPSE_01715Help
Entry
FPSE_01715        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
fpu  Fusarium pseudograminearum
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fpu04131]
    FPSE_01715
Enzymes [BR:fpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     FPSE_01715
Membrane trafficking [BR:fpu04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    FPSE_01715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Ank_2 Ank_4 Ank_3 Ank Ank_5 PocR
Motif
Other DBs
NCBI-GeneID: 20360335
NCBI-ProteinID: XP_009253110
UniProt: K3VSI0
Position
4
AA seq 720 aa AA seqDB search
MASINTTSTSGGSAAPIQMSGKANAATPKLNSEVEMGSLPGDAQTQEDDIMQVARVGDVP
AMEKLFESGEYDATYHDDEGITPLHWAAINNQYAMCKFLIEHGAEINRKGGESIATPLQW
AAQRCHYYTVNLLLQHGADPLVTDAQGYNTLHISTFNGNVLLLVLLLHQGIPVDVIDTFG
HTALMWAAYKGFPQCVDLFLRWGASVHATDEQGFTALHWALVKGSPGCILKLIEYGADRF
AKTQTGKTPSVTAKELNTEVAWHRALTECGFDEDGHPAVPPWPGASYFLKDKRSFVTRFL
FFWPFVLVWAMLVAMSSAPVYIGVPLGIAAVYAIQWVAQQVLEYAPSDMRHFHKTPWLTG
IFAATLFWTGVNWLTTVLFATTLGASEGKGHGILNLLFALFFGFTVYFYIASMRYDPGFV
PKMNGIAEQKAVIDELLAQWKYDETNFCVTCMIQTPLRSKHCRRCQRCVAKHDHHCPWVY
NCVGINNHRHFFFYLISLTMGIISYDFLLYYYFDTVSKNASETCNVLSPTLCKYINADSY
TSILAIWITMQLLWVTMLLFTQFIQVARAMTTYENMFGIRDGTNITALTSTGAPLDPNHP
SLSATGPAAAHSHKHKGGMLKSLSRTLGVDPFIETITGRGAVSGKNKRKKKNPYSKGCIT
NCKDFWCDPAPIFGQRENGSAVLGGERVDYSAMYESPSLMTITGRRDRGGYEAVGTEDVV
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcataaacacgaccagcacatcaggcggatcagccgcgccaattcaaatgtcg
ggaaaggccaatgctgctacgcccaagctcaacagcgaggttgagatgggcagtctgccg
ggagatgcccagacccaagaggatgatattatgcaggtggcccgcgtaggagacgtaccg
gccatggagaagctcttcgagtcgggcgagtacgatgcgacctaccatgatgacgagggt
atcacgcccttacattgggctgcgattaacaatcaatatgcaatgtgcaaattcttgatc
gaacacggcgccgaaatcaacagaaaaggcggcgaatccatcgcaactcctctccaatgg
gccgctcagcgatgccattactataccgtcaatctgctactccagcacggcgccgacccc
ctcgtcaccgatgcccaaggctacaacacccttcacatctcgacattcaacggcaacgtc
cttctcctggttctactcttgcaccagggaattcccgtcgatgtcatcgacacctttggc
cacacggcgctgatgtgggctgcttacaagggctttccccaatgcgtcgatctcttcctc
cgctggggcgcaagcgtccacgcgaccgacgagcaaggcttcaccgcgctgcattgggct
ttggttaaaggaagtcctgggtgcattctcaaacttatcgagtacggtgccgaccgattt
gcaaagacacagacgggcaagactccttctgtgacggcaaaggaactcaacaccgaagtc
gcctggcacagagccctgacagaatgcggtttcgacgaggacggtcaccctgcggtgcct
ccttggcctggtgctagctacttcttgaaggacaagaggagttttgttactaggtttttg
ttcttttggccatttgttttagtatgggctatgctcgtcgctatgtcgagtgcgcccgtg
tatattggtgtgccacttggaatcgccgctgtttatgctattcagtgggttgctcagcaa
gtgttggagtatgcgccttcagatatgcgacatttccacaagacgccttggttaactggc
atctttgccgcgacacttttctggactggtgtcaattggttgacgacagtcctctttgcg
acaacactcggcgcaagcgaaggcaaaggccatggcatactcaacctcctttttgccctc
ttcttcggctttacagtgtatttctacattgccagcatgagatacgaccccggttttgtt
cccaagatgaacggtatcgctgagcaaaaggccgttattgatgagctccttgcccagtgg
aaatacgacgagaccaacttttgtgttacatgcatgattcagacgcctcttcgaagcaag
cattgccgtcgctgccagcgatgcgttgccaaacatgaccatcattgcccatgggtctac
aactgtgtcggtatcaacaaccaccgacactttttcttctacctcatttcacttactatg
ggtatcatctcgtatgacttcctgttgtactactactttgacactgtcagcaagaatgct
tcagaaacttgcaatgtccttagccccaccctttgcaagtacatcaacgccgactcatac
acctctatcctggctatctggatcactatgcaactgctttgggtcaccatgcttttgttc
actcagttcatccaggtcgcacgggctatgactacgtatgagaacatgtttggtatccgc
gatggcaccaacatcaccgctctcacatctactggcgcgcctctcgaccccaaccacccg
tctctatctgctacagggcccgctgctgctcactctcacaagcacaagggtggcatgctc
aagtcactgagccgtactcttggtgtggatccattcatcgagaccatcaccggacgtggc
gccgtatctggcaagaacaagcgcaagaagaagaacccctacagcaagggctgcatcacc
aactgcaaagacttttggtgcgatcccgcccctatctttggacaacgagagaacggatct
gcagtgcttggtggcgagcgagtcgattacagtgccatgtacgagagtccaagcttaatg
acaatcacgggtcgacgagatcgcggaggttacgaggcagtaggaacagaagacgttgtc
tag

DBGET integrated database retrieval system