KEGG   Fusarium pseudograminearum: FPSE_01725Help
Entry
FPSE_01725        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K09578  peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
fpu  Fusarium pseudograminearum
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fpu03021]
    FPSE_01725
   03110 Chaperones and folding catalysts [BR:fpu03110]
    FPSE_01725
Enzymes [BR:fpu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     FPSE_01725
Transcription machinery [BR:fpu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     FPSE_01725
Chaperones and folding catalysts [BR:fpu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    FPSE_01725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase Rotamase_3 WW Rotamase_2 WW_1
Motif
Other DBs
NCBI-GeneID: 20360345
NCBI-ProteinID: XP_009253120
UniProt: K3VSI6
Position
4
AA seq 177 aa AA seqDB search
MADTGLPPGWEVRHSNSKNLPYYFNSAEKLSRWEPPSGTDTDKLKHYMATNHSAGSRPGA
VPGVPEGKIRAAHLLVKHRDSRRPSSWKEAEITRSKEEAFEIIKEHENKIKAGGVSLGEL
ALTESDCSSARKRGDLGYFGRGDMQKEFEDASFGLSPGQMSEIVETASGLHLIERLE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaccggtcttcctcctggctgggaggtccgacactccaactcaaagaacctc
ccctactacttcaactcggccgagaagctgtcgcgatgggaacccccctccggcaccgac
accgacaagctcaagcactacatggccaccaaccacagcgctggttcgcgtcccggtgcc
gtccccggtgtccccgagggcaagatccgagctgcccatcttctcgtcaagcatcgcgac
agccgacgacccagcagctggaaagaggcagagattactcgctccaaggaggaggctttc
gagatcatcaaggagcacgagaataagatcaaggcgggaggcgtcagccttggcgagctt
gctctcaccgagtctgactgctcctctgctcgcaagcggggagatttgggatactttggc
agaggagatatgcagaaggagtttgaagatgcttcctttggtctttcgccaggccagatg
agcgagatcgtcgagacagccagtggtctgcacttgattgagcgtttggaataa

DBGET integrated database retrieval system