KEGG   Fusarium pseudograminearum: FPSE_02052Help
Entry
FPSE_02052        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00564  Glycerophospholipid metabolism
fpu00565  Ether lipid metabolism
fpu00590  Arachidonic acid metabolism
fpu00591  Linoleic acid metabolism
fpu00592  alpha-Linolenic acid metabolism
fpu01100  Metabolic pathways
fpu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FPSE_02052
   00565 Ether lipid metabolism
    FPSE_02052
   00590 Arachidonic acid metabolism
    FPSE_02052
   00591 Linoleic acid metabolism
    FPSE_02052
   00592 alpha-Linolenic acid metabolism
    FPSE_02052
Enzymes [BR:fpu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     FPSE_02052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 20360671
NCBI-ProteinID: XP_009253446
UniProt: K3VR04
Position
2
AA seq 707 aa AA seqDB search
MVILTSIRKSPAYLYAKTYCLCALVSLVQATPISSRFRPANLTRPTRFRNGKALTSRIAP
DNEPDKVSSSKTTRIIDRWYARVADLASVKTSLKRDETDIATYRELQWDAKVRHGSSLHP
KEQEFIQLRKAMISSQGKNSLHNFLGLPPDEIVDPRDVPLLSLGGSGGGYRVMYGFTGFI
VAAKKAGLWDCITWTAGVSGSCWTIAAYYTIARHDISRLVDHYMTVASELAHPMSMYALD
KVARSKRGIYFLIGPLVSKAQKSIIGLSVMDLYSTLTATYQLLSREPKGRLSRATFQWSR
IWQRSGIDKALEPMPILAAVRRVPRYSYKPKTISTKATAIQNDNIAGNMDPMRNGSENKS
KDSSKKLFQYFEISPLEIGSPDLNRYVPTWSWGRTFVSGHSVDRRPEQSFSLLLGQCTSA
PAGPLTECIKALLVSIPKDTVMARLVAMLNRFLQSKHLEGFWGNPIRAGHDPNPFYGLEK
PAMAREHTSEHPSYRPRATEPEVTERRSLMTMTNSPAVDLPPWEAQGRTRLMDCGMANNL
PNHVLARPERGVDIFISFDSSSDVQTGAAVQRLHHFAADFDFELQEETKVFHSPRRNVEL
ASDHGLEVESRYLHQYGRVFRGTRESGKTIYIIYCPLLPNGINPNFNPSTASFSTSTNLM
WTPDQVQSVLTTAEANITNYAFDTIKRVVRKVYEDKKAHRQTLETMS
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggtcattttgacatcaatccgaaagtccccagcttatctttacgccaaaacgtattgc
ctctgcgcgctggtcagcctcgttcaagcaacacccatctcatcgcgatttcgaccagcc
aatctgacaaggccaacgcgctttaggaatggaaaggccttgacatcccgaatagctcca
gacaatgagcctgataaggtctcgtcatccaagacgacgcgtattattgatcgatggtat
gccagagttgcggatttggcttcggtgaagacctcactaaaacgcgatgaaacggatatt
gcgacgtatcgcgagttacagtgggatgcaaaggtccgtcatggctcatcgttacaccca
aaagaacaagaatttatccagttgcgaaaagcaatgatctcatctcagggtaaaaactca
cttcacaactttctcggtcttccaccagacgaaattgtcgacccaagagatgtcccactc
ctctccttgggaggctcaggtggtggctatagggttatgtacggcttcacaggcttcata
gtcgctgctaaaaaggcaggcttgtgggattgcatcacctggactgccggtgtgagcgga
agctgttggacgatagcagcgtactacacaattgccaggcacgatatctccagacttgtt
gatcattacatgactgtagcaagtgaactcgcgcacccgatgagtatgtatgctcttgac
aaggttgcgcggagtaaaagaggtatatacttcttaattggccctctggtgagcaaagcc
cagaagagcattattggattgagtgtcatggacctttattctactctcacagcaacatat
caacttttgtcgagggaaccaaaagggagactgagtagagccacatttcagtggtctaga
atttggcaaaggtcaggaatcgacaaggcactggagccgatgccaattctcgccgctgtc
agacgtgtcccaagatactcatacaagcccaaaactatttccaccaaggccacagctatt
cagaacgataatatcgcgggaaacatggatccaatgcgcaacggctctgagaacaagtcc
aaggacagttccaagaagttgtttcagtacttcgagatttcacccttggaaataggcagt
ccagatctgaatcgatacgtgcctacttggtcttggggacgcactttcgtttccggccat
tcggttgaccgtcgaccggagcaatcattttcacttttactgggacaatgcaccagtgca
ccagcggggccgttgacagagtgtataaaagctctcttggtgtcgatccccaaagacacg
gtaatggcgcgcttggtagccatgctcaacaggttcttgcagtcgaagcatttggaaggg
ttctgggggaatccgatccgagcaggacacgacccaaatccattctatggactggagaaa
cctgccatggcaagagaacatacttctgaacatccctcatacagaccacgagcgactgaa
cccgaggttacggagagaaggagtcttatgaccatgactaacagtcctgctgtagacctt
ccaccatgggaagcgcaaggacgtacaagactcatggactgtggaatggccaataatctt
cccaaccatgtccttgcgaggccagaaagaggcgttgacatttttatctcttttgattca
tcctcggatgtgcagactggagcagctgtgcagcgtctacatcacttcgctgcagacttt
gactttgaactacaagaagaaactaaagtcttccacagtccgaggagaaacgtcgagctg
gcttcggatcatggactggaagtcgagtcacgatatctccatcaatatggcagagtgttt
cggggtacgcgcgagagtggaaagaccatttacatcatttactgcccacttttgccaaat
ggcatcaacccaaacttcaacccttcgacagcctccttctcaacctcgacaaacctcatg
tggacaccagaccaagtccaaagcgtgcttacaacagctgaagcgaacatcacaaattat
gctttcgatactataaaacgggtagttagaaaggtgtatgaagacaaaaaggcacataga
cagacattagagaccatgagttaa

DBGET integrated database retrieval system