KEGG   Fusarium pseudograminearum: FPSE_02742Help
Entry
FPSE_02742        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
fpu  Fusarium pseudograminearum
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fpu03400]
    FPSE_02742
Enzymes [BR:fpu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     FPSE_02742
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     FPSE_02742
DNA repair and recombination proteins [BR:fpu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     FPSE_02742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC HAD_SAK_1
Motif
Other DBs
NCBI-GeneID: 20361361
NCBI-ProteinID: XP_009254136
UniProt: K3VSN5
Position
4
AA seq 855 aa AA seqDB search
MDAFVTRLPKPQSQLRGQIRPDSLDLPTQERPSKRAKRQGSSDSDSDQSHDSRNEASPRK
KFVSKKSTEDDDLDSGNPRPTDIESALPPTADGREAIEEYEAMKSSQVTAGEDDDDATEK
PKPRWIKGQTSIYVDAFNLALDTVLDEESHLFDEKENDVFKQWRDLGYEAQYLYVRLFLR
KAAWWHRHNRLDYHSDVSNLEAAIATLQSPRALPHDAIPPTQSPVHGIELEEYRLGGTFT
FADASNEHIDSVEEAASLLSLDELKDLAKEAKIQGRNKSELTRSLVRMSKQQAGLMSVGL
SRHNSRNSPSEDQENKDVKVIAKAKLRREDSNREQHFLTKILAILGPCIRLSPLAFKLFE
RVHLVFYRSTEWTEKSLTTIILAKIARRHFPEYIVCRTSTIFASRLHLLEYETAIRMETE
VDNLEFNSPPGQEGLRMMIDVFDRVYPRWQTLVKEEQKKEHTVYEMGEGTYLRRFTPGHS
YTRIVHKAAPIFGKLKEHLKEHSLLTELLGQRLFHPARRGGWYQRKALLEEHYMPTLDPN
PKFTDPEQQKKHWKKKAVATCEAGLQDPDCHLIFHYDLQKRLVKLEKKLRIPRRLQHDFG
HVNLEKPTVHTIEGIQIKKDIIAKPGRQVSTKTIWFDELGSKEECSVEEMCLSQYRSEGW
KGYHAEGGIIRTLFAYLFYDILFIYIPNVFQTAYQTCPLDLHTDAFYPSRASEINHRLVE
IANGEAARLLREVWDKEHEKRTSVVGLNWDFEIDDLVELVECFEGSALAAVCKVMAQEYR
QRGGGIPDLILWRIADTPKEQTKEPGKAKGEVMFSEVKSANDRLSDTQRLWIHVLTGAGV
KVALCNAVAKEVRED
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggacgcatttgtgacaaggctccctaagccgcaaagtcagctccgtggtcaaattcga
cctgactctttggatcttccaacccaggagagaccctccaagcgagccaaacggcaggga
tcatcggattccgatagcgatcagtcccatgattctcgcaatgaggcttctccgaggaaa
aagtttgtcagtaagaaatcgaccgaagatgatgatctagatagtggaaatcctcggccc
acagacatagaaagtgcattacctcctactgccgatggcagggaggcgattgaagagtat
gaggcgatgaagtcatcgcaagtgacagctggagaagatgatgacgatgcgacagaaaaa
ccaaagcctcgttggatcaaaggccagacttccatctacgtggatgctttcaatctcgct
ctcgatactgttttagacgaagaatctcatctgtttgatgaaaaagaaaatgacgtcttc
aaacaatggagggatctagggtacgaggctcaatatctctatgttcgactgtttctcagg
aaagctgcatggtggcatcgtcataaccgtcttgattaccacagcgacgtttcaaatctc
gaagcagctatagctacgctacaatcacctcgtgcattaccacacgatgccatacctcca
acacagagccccgtgcatggtatcgaacttgaagagtataggctaggtgggacattcacg
tttgcggatgcatcaaatgaacacatcgattcagtcgaagaggctgcatcgctgctcagc
ctggatgagttgaaagatctggcaaaggaagccaagattcaagggcgcaacaaatcagaa
cttacccgttcccttgtgcgaatgagcaagcaacaggctggtttgatgtcagtcggcctc
agcagacacaacagccgtaactcgccttctgaggaccaagaaaataaagacgtgaaagta
atagccaaggcaaaactccgacgagaagactcgaacagggaacaacacttcttaaccaaa
atacttgctattctcggcccttgcattcgattatcaccgctggccttcaagctttttgag
cgcgtgcatctggtgttctacagatcaaccgaatggacagagaagtccctcacaacaatt
attctcgccaaaattgcgcggcgccattttcctgagtacattgtctgtcgaacttcaacg
atatttgcatcacggttgcacttgttagaatatgaaaccgctattcgcatggaaacagaa
gtcgacaatttggagttcaacagcccacctggacaggaaggtctcagaatgatgattgac
gtatttgacagagtttatccccgatggcagacgttagtcaaggaagagcagaaaaaggaa
catactgtatatgagatgggcgaaggcacatacctgagacgattcacaccgggtcactct
tatacaaggatcgttcacaaagcagccccgatatttggaaagctcaaagagcatctcaag
gaacatagtcttctcactgagcttctcggtcagcgattattccacccagccaggcgaggt
ggttggtatcagcgaaaagctctcctagaagagcattacatgcccactttggacccaaat
ccaaaatttacagaccccgaacagcagaagaagcattggaaaaagaaagcagtcgcaact
tgtgaggctggcttgcaagatccagactgccatctcattttccattacgacctgcagaaa
cgtttggtcaagcttgagaagaaactgcgcattccacgccgcttgcagcacgactttggc
catgtgaacctagaaaagcccactgtgcacacaatcgaagggatccagatcaagaaggac
attattgccaagcccggtcgccaagtgtcaacaaagacaatatggtttgatgagctgggc
tcaaaagaagagtgcagcgtcgaagagatgtgtctcagccagtatcgatcagaaggatgg
aaagggtatcacgccgagggtgggattatccgcactttgtttgcatacctcttctacgat
atcctgttcatctacatcccgaacgttttccagactgcctatcaaacatgcccgttggat
ctacacactgatgctttttacccgtccagagcatcggaaattaaccacagacttgttgaa
attgccaacggagaggcggcaaggttattgcgcgaggtctgggataaagaacacgagaaa
aggaccagtgtggtaggcttgaactgggactttgagattgatgatctcgtggagcttgtc
gaatgcttcgagggcagcgctcttgcagctgtatgcaaggtgatggctcaagaatacaga
cagcggggtggaggcatcccggacctcatcttgtggcgtattgcagatacgccaaaagaa
cagaccaaagaacctggaaaggcaaagggagaggtcatgttctctgaagttaagagtgcg
aacgatcggctcagtgatactcaacggctctggatccatgttcttacaggagcaggggtc
aaggttgcgctctgcaacgctgtagcaaaggaagtgagggaggattag

DBGET integrated database retrieval system