KEGG   Fusarium pseudograminearum: FPSE_03777
Entry
FPSE_03777        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00100  Steroid biosynthesis
fpu01100  Metabolic pathways
fpu01110  Biosynthesis of secondary metabolites
Module
fpu_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    FPSE_03777
Enzymes [BR:fpu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     FPSE_03777
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 20362396
NCBI-ProteinID: XP_009255172
UniProt: K3W1J4
Position
1
AA seq 481 aa
MKAPDSPRYEFGGPLGATGIVFGLPILMQVLYLGCNDVSGCPAPALLDPKTLSWAKLKSQ
IPWPQEGLSGFMSWEVTKWLFAYYFLSLVLYRIMPAQVVLGTKLRESGKPLEYRFNSFSA
TVVQLTGCAIGTYIYGANFPVWTWITDHYIQLLTTSTVLTYIISIWTYLRSFSIKPGNPE
LREVAVGGRTGRVIYDYFIGRELNPRVTLPFFGEIDIKAWLEMRPGLTGWILLNCSFIAK
QYRTYGFVSDSIVVIALIQAYYVLEGQYSEAGLLGMMDITSDGLGFMLTWGDIVWVPFLY
STQCRYLSVYPVHLGPIGVGAIGTVFCIGLYIFRSSNNQKALFRKDPNNPAFANMTYIQT
KRGTKLLTGGWWGMARHVNYLGDWIQSLPFCLPTKAAGYVILPAGTAVAGAEVAKMLDGR
LVTPGDAAPWGMLFTYLYSAWFGFLLIHRERRDDYACSEKYGKDWEEYKNKVRWRVLPGV
Y
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaaggctcccgactctcctcgctatgaattcggtggccctctcggcgccactggtatc
gtctttggtcttccaattctcatgcaagttctctacttgggctgcaacgatgtatcgggc
tgccccgcacctgctctgcttgatcctaaaactctaagctgggccaagctcaagtctcag
attccctggcctcaagagggtctctctggattcatgtcctgggaagtcacgaagtggctt
tttgcttattattttttgagtcttgtgctttaccgcattatgcccgctcaggtcgttctt
ggtacaaaactgcgcgagtctggcaagccccttgagtatcgctttaattctttctctgct
accgttgttcaattgactggttgcgctatcggaacctacatctacggcgccaacttcccc
gtctggacatggattaccgaccactatatccagcttctcacaacaagcacagtcctcacc
tatatcatctccatctggacttatctccgcagcttctctatcaagcccggaaaccctgaa
ctccgagaggtcgctgtgggaggccgtaccggacgagtcatctacgattacttcatcggt
cgtgaactcaaccctcgtgtgactctccctttctttggcgagattgacatcaaggcgtgg
ctggaaatgagacccggccttactgggtggatcttgcttaactgttcgttcatcgcgaaa
caatacagaacttatggctttgtctcagatagtatcgtggtcattgcgttgatccaggct
tactatgttcttgaagggcaatattccgaggctggactattgggcatgatggatatcact
tcggatggactgggtttcatgcttacatggggtgacattgtgtgggtgcccttcctctac
tcaacccaatgccgttatctctccgtctaccccgttcacctgggccccatcggcgttgga
gcaattggcactgttttctgcattggtctctacatcttccgctcttccaacaaccagaaa
gcccttttccgcaaagatcccaacaacccagccttcgcgaacatgacttacattcaaacc
aagcgcggaacaaagctcttgacaggcggttggtggggaatggctcgtcatgtgaactac
ttgggtgactggattcagtcccttcccttctgcctgcccaccaaagccgctggctacgtt
attcttcctgcaggtacagctgttgctggagccgaagtggcgaagatgcttgatgggcga
ttggttacacctggtgatgctgcgccgtggggaatgctgtttacgtatttgtattcggct
tggttcggattcttgcttattcatcgcgagagacgagacgattacgcctgctcggagaag
tatgggaaggattgggaggagtacaagaacaaggtccgatggagagtcctgcctggcgtg
tactaa

DBGET integrated database retrieval system