KEGG   Fusarium pseudograminearum: FPSE_03784Help
Entry
FPSE_03784        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00052  Galactose metabolism
fpu00500  Starch and sucrose metabolism
fpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    FPSE_03784
   00500 Starch and sucrose metabolism
    FPSE_03784
Enzymes [BR:fpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     FPSE_03784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 20362403
NCBI-ProteinID: XP_009255179
UniProt: K3VLZ5
Position
1
AA seq 549 aa AA seqDB search
MRSNLLSTVVGLSQFYSVAIAQSSTTITVPTGTPVPGNYNGTYRPQVHFSPPEHFMNDPN
GMFRDADGLWHLYYQYNPTALVAGNQHWGHATSKDLYHWVNQPIALFPPEKDTYVFSGSV
VVDENNTSGFFPDQDNGVVAIYTLSSPEVQDQAIAYSRDGGYTFEPYKGNPVIPSTSTQF
RDPKVIRYKDSWIMVVAYPQDFAIGIFESPDLKEWTATSNFSHHGLLGLQYECPNMISIP
YYDEDGKKQDDMWLMVISINPGAPLGGSIAEYFPGHFNGTHFEAVDAAARIADFGKDNYA
GQWFYGLSEDENPVSIAWASNWQYTQTVPTEDEGWRSAMTLPRENYLTKAKRAGWKLVSK
PYDLEPVMGRELASNDSFGNSNITVDYSDVESNAIYWEVNVTGLPDFGIPSTALMNFTFM
SPVSGESVKAGYYFGGDAVYFLDRGNTRGFDNIFFTDKTSLGSLPASDGSWNTSGVIDRS
IFEGFLNGGVDSVTNTFFATEPLTLMMFSTSDLPEEVKVSISVYALDSAWQKMEGKDGLV
HGNTTSKAD
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcaatctcttgtcgaccgttgttggtctttcccaattttattctgtggccatt
gcccagtcttccaccaccatcactgttcccactggcacacccgttcctggcaactacaat
ggcacctatcgtccccaagtccacttctctccacctgaacatttcatgaatgatcccaat
ggcatgttccgtgatgctgatggcctgtggcatttgtactaccagtacaaccctacagct
ctcgtcgctggcaaccagcactggggccatgcaacatcaaaggacttgtaccattgggtg
aaccaacccattgccttgtttcccccggagaaagatacctacgtcttctctggaagtgtg
gttgtcgatgagaacaacacttctggcttcttccctgaccaagacaatggtgtcgtcgca
atctatactctatcatcgccagaagttcaggatcaagctattgcctactcccgagacgga
ggctacactttcgagccttacaagggcaacccagtcatccccagcacttctacccagttc
cgtgatcccaaggtcattcgctacaaggactcttggatcatggtggttgcataccctcaa
gactttgccatcggcatctttgagtcccctgatctgaaagaatggaccgccaccagtaac
ttttcccaccatggtctgctcggcctgcaatatgagtgtcccaacatgatctccatccca
tactacgatgaagatggcaagaaacaggatgacatgtggctcatggtgataagcatcaac
ccaggtgctcccttgggcggttctatcgctgaatacttccccggccacttcaatggtacc
cactttgaggccgttgacgctgctgcgcgaattgcggatttcggaaaggataactacgcc
gggcaatggttctacggactttctgaggatgaaaaccccgtctccatcgcttgggcttcc
aactggcagtacacacaaaccgtccccacagaagatgaaggctggcgaagcgccatgact
cttcctcgcgagaactatttgaccaaggcaaagcgtgctggctggaagttggtatctaag
ccctacgaccttgagccggtcatgggccgtgagctcgcttccaacgatagctttggcaac
tcaaacatcactgtggactactccgatgttgagtccaacgcgatttattgggaagtcaac
gtcactggcctcccagattttggcatcccttcaactgcattgatgaacttcacattcatg
tctccggtctccggcgaaagtgtcaaagctggctactacttcggtggcgacgcagtgtac
ttcctcgatcgtggcaacacccgcggcttcgacaacatcttcttcactgacaagacatct
cttggaagtctgccagccagtgacggctcatggaacacaagcggcgtgattgatcgttct
atctttgaaggtttcctcaatggaggcgtcgacagcgtgacaaacacgttcttcgccaca
gagccattgacgctcatgatgttcagcacatctgatctacctgaggaggtcaaggtcagc
atcagtgtgtatgctttggatagtgcatggcaaaagatggagggcaaggacgggcttgtg
catggaaacacaacttccaaggcagactag

DBGET integrated database retrieval system