KEGG   Fusarium pseudograminearum: FPSE_03840Help
Entry
FPSE_03840        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00071  Fatty acid degradation
fpu00410  beta-Alanine metabolism
fpu00592  alpha-Linolenic acid metabolism
fpu00640  Propanoate metabolism
fpu01040  Biosynthesis of unsaturated fatty acids
fpu01100  Metabolic pathways
fpu01110  Biosynthesis of secondary metabolites
fpu01212  Fatty acid metabolism
fpu04146  Peroxisome
Module
fpu_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
fpu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    FPSE_03840
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FPSE_03840
   00592 alpha-Linolenic acid metabolism
    FPSE_03840
   01040 Biosynthesis of unsaturated fatty acids
    FPSE_03840
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FPSE_03840
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    FPSE_03840
Enzymes [BR:fpu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     FPSE_03840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1 DUF3016
Motif
Other DBs
NCBI-GeneID: 20362458
NCBI-ProteinID: XP_009255233
UniProt: K3VQA8
Position
1
AA seq 696 aa AA seqDB search
MPPPNPDWVKALTPSGPQGSELIAKERAQSDINVDQLATFLFTKEVLERNARILKILQED
PVFDKSQNYFRGRTDRLEAALARGKHLKRLRDKHNWTEEEHHVANDLISEPTPYGLHSTM
FLKTLEEQGTPAQHELFLEKARNYEIIGCYAQTELGHGSNVRGLETTATWNPEDKTFTLH
SPHLTASKWWIGSLGKAANHAVVVAQLILNGKSYGPHPFVVPIRDMKTHEPLENIHVGDI
GPKFGYNTMDNGFLLFNHVKIPHVNMLNRFSGIDPETSKYIRPSNPALIYGTLTFIRSSI
VFQSGSVLARGVTIATRYCAVRRQFQDRDADAGEVGENQVLNYTMVQHRLLPLLASAYAL
HFTGRSMINLYNANQKRMAQGRERDNSKRAPGPEELSPGSDHLADLHAISCSLKAFASTT
AAEGLEVCRRACGGHGYSAFSGIGSWYADYLPTVTWEGDNYMLTQQVARYLLKSARAVLA
GKAPDNGISRIFKEFIRRQDIGAAFDVLDSDQDLVDAFAWRVSFLTFEALKHRDEEKQSW
NSLLIDFWRLSTAYAQYQVVKNFHEALKEESTKSSLDANTLTLLHKLFELFALHHLQSSA
SEFFTSAATTVRQIQLARTKRTLSLLDEVRPHAVRLVDAWSFPDWQLDSALGRADGKVYE
DLFRRASEDNPVNDIVFDSNPASDILFRKTGPKAKL
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctcctaatccagactgggtcaaggccctgactccctcaggtccccaaggatca
gagctcatcgccaaggaacgcgctcaatcagacatcaacgtcgaccaactcgccacattc
ctcttcacaaaggaagttctcgagcgcaacgccagaatcctcaagattcttcaggaagac
cctgtctttgacaagtcccagaactacttccgtggccgcacagatcgtctcgaggctgct
ctcgctagaggaaagcatttgaagcgtctacgcgacaagcacaactggacagaggaggaa
caccatgttgcgaatgatctcatcagcgagcctacaccttatggtctgcactccacaatg
ttcctcaagacactcgaggagcaaggaacaccagctcaacacgagcttttcctcgaaaag
gccaggaattatgagatcatcggatgttatgcccagactgagttgggtcacggatccaac
gtgagaggtcttgagaccaccgccacctggaaccccgaggacaagacattcactctgcac
tctccccatctcactgcttcaaaatggtggatcggttctctcggcaaggcagctaaccat
gccgtcgtcgtcgcccagctcatcctcaacggcaaatcctacggtcctcaccccttcgtc
gtgcccattcgcgacatgaagacccacgagcctctcgagaacatccacgtcggtgatatc
ggccccaagttcggttacaacaccatggacaacggattccttctcttcaaccacgtcaag
atcccccacgtcaacatgctcaaccgtttctccggcattgaccccgagacatcaaagtac
atccgcccttcaaacccagctctcatctacggaactttgacctttattcgatcatccatc
gtcttccagtctggctctgttcttgctcgcggtgttaccatcgctacaagatactgtgct
gtccgacgacagttccaggaccgcgatgccgacgctggcgaggtcggtgagaatcaggtc
cttaactacaccatggtgcagcaccgtctccttcctctgctcgcctccgcttatgccctt
cactttaccggtcgctccatgatcaacctctacaacgcgaaccagaagcgcatggctcaa
ggccgagaacgcgacaacagcaagcgtgctcccggaccagaggagctcagccctggcagt
gaccacttggccgatctgcacgccatctcctgctccctcaaggcttttgcttccaccacc
gctgccgagggtcttgaagtctgtcgtcgcgcttgcggtggccatggctactctgccttc
tctggcattggtagctggtacgccgattatctccccaccgtcacatgggagggcgacaac
tacatgctcacccagcaagtcgcccgctacctcctcaagtctgctcgcgccgtcctcgcc
ggaaaggcgcccgacaacggcatctcccgcattttcaaagagttcatccgaagacaggac
attggcgctgcctttgatgttctcgacagcgaccaggaccttgttgacgctttcgcctgg
cgcgtatctttcctcacctttgaagctctcaagcacagagatgaggagaagcagtcatgg
aacagtcttttgatcgacttctggcgtctgtccaccgcgtatgcccaataccaggtagtt
aagaacttccacgaggcactcaaggaggaatccacaaaatcttctctcgacgccaacacc
ctgactctcctacacaagctctttgagcttttcgccctgcaccacctccagagctccgct
tccgaattcttcaccagcgctgccacgacggttcgccagatccagcttgcgcgcacaaag
cgaacactgtctctgctggatgaagtccgccctcacgctgtgcgtctcgtcgatgcgtgg
tcgttccctgactggcagcttgacagtgctctgggacgagctgacggcaaggtgtacgaa
gacctgttccgtcgtgcttcggaggataaccctgttaacgacatcgtctttgactctaat
cctgcgtcggatatcttgttccgaaagactggacccaaggccaagttgtaa

DBGET integrated database retrieval system