KEGG   Fusarium pseudograminearum: FPSE_05121Help
Entry
FPSE_05121        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00020  Citrate cycle (TCA cycle)
fpu00640  Propanoate metabolism
fpu01100  Metabolic pathways
fpu01110  Biosynthesis of secondary metabolites
fpu01130  Biosynthesis of antibiotics
fpu01200  Carbon metabolism
Module
fpu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FPSE_05121
   00640 Propanoate metabolism
    FPSE_05121
Enzymes [BR:fpu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     FPSE_05121
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FPSE_05121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 20363739
NCBI-ProteinID: XP_009256514
UniProt: K3VM28
Position
1
AA seq 329 aa AA seqDB search
MQSITRATRASALKNVGRRAYSSSQYAKTINNLRINSDTKVIYQGFTGKQGTFHAEQAIE
YGTKVVGGTNPKKAGQTHLGLPVFKNVSEAVKATGATATGLFVPPPLAAAGIEEALEAEI
PLVVCITEGIPQHDMVRITDMLKTQDKTRLVGPNCPGIIAPEQCKIGIMPGFIHKRGRIG
IVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFSGTNFIDCLKVFTEDPNTDGIIMIGE
IGGSAEEDAAEFLKQANTVNGGKPVVSFIAGISAPPGRRMGHAGAIVSGGKGGADTKIKA
LEDAGVIVERSPAGLGKALYNEFVRRDLL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccatcaccagagccactcgcgcttctgcgctgaagaacgttggccgccgcgcc
tactcttcgtcgcagtacgccaagaccatcaacaacctgcgcatcaacagcgacaccaag
gtcatctaccagggattcaccggaaagcagggaactttccacgctgagcaagctatcgaa
tacggcaccaaggtcgtcggtggaacaaaccccaagaaggctggccagactcaccttggc
cttcctgtcttcaagaacgtctcagaagccgtcaaggctactggcgctaccgctactggt
ctcttcgtccctcctcctctggccgctgccggtatcgaggaggctctcgaggccgagatc
cccctcgttgtctgtatcactgagggtatcccccagcatgacatggttcgcatcaccgac
atgctcaagactcaggacaagacccgtctcgtcggccccaactgccccggtatcatcgcc
cccgaacagtgcaagattggtatcatgcctggtttcatccacaagcgcggtcgcatcggt
atcgtctcccgttccggtaccctgacctacgaggccgtcaatcagaccacccaggccggt
ctcggtcagtctctcgtcgtcggtattggcggtgaccccttctccggcaccaacttcatc
gactgtctcaaggtcttcaccgaggaccccaacaccgacggtatcatcatgattggtgag
attggtggttccgccgaggaggacgccgccgagttcctcaagcaggccaacaccgtcaac
ggtggcaagcccgtcgtcagcttcatcgctggtatctccgctccccctggacgacgaatg
ggtcacgccggtgccatcgtctccggcggcaagggtggtgccgacaccaagatcaaggct
cttgaggatgctggtgtcattgtcgagcgctcccccgctggtctgggcaaggctctctac
aacgagtttgtccgccgcgatctgctataa

DBGET integrated database retrieval system