KEGG   Fusarium pseudograminearum: FPSE_12314Help
Entry
FPSE_12314        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00970  Aminoacyl-tRNA biosynthesis
fpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FPSE_12314
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fpu03029]
    FPSE_12314
Enzymes [BR:fpu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     FPSE_12314
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     FPSE_12314
Mitochondrial biogenesis [BR:fpu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    FPSE_12314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase TORC_M Big_3_5
Motif
Other DBs
NCBI-GeneID: 20370931
NCBI-ProteinID: XP_009263706
UniProt: K3V3X0
Position
3
AA seq 513 aa AA seqDB search
MMSTALVRQSASRPSRYCKRTLSVTFSARPAIQWRSHSSYNHFVGHTKLAAADPNADFLP
FMCKDVKPFTLAVKDNIATSEFPTQCASHILSAHPSPFEATVVRQLRKRGATVVGKTNMD
EFGMGSHSSNSVHGAVRNPLAKDGNVSAGGSSGGSAVAVRLGDADVALGTDTGGSIRLPA
AYTGTVGYKPSYGMISRFGVVPYANSLDTVGFMANDVKPIHDLVFKTKMHEEHDSEDPTS
LPSTSRRRCAETIPSALPDLSKLNIGVPLEYNIDELDPSIRAAWVSAASSMEAQGATLVP
ISLPSTREALCAYYVLAPAEASSNLAKYDGVRYGKRGEGSDAVGETLYSDTRGEGFGEEV
RRRILLGTYSLSSEAIDNYFIQAQKVRRMVQQDFDRVFRLDNPLYEPEQFDLSDMAEATG
MEDKTGPVQVDFILCPTAPTFPPRLEEIEEQSSVDAYMNDVFTVPASLAGLPAVSIPAKV
EGSQFPAGLQVIGQYWDDQRVLQLAEKLKFMVV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcacggctcttgtgcgacaatcggcctcgagaccttctcgatactgtaaaaga
actctttcagttacttttagtgcacgaccggccatacaatggcgctcacatagtagctac
aaccactttgttggtcatactaaactcgctgccgcagacccaaatgccgatttccttcct
ttcatgtgtaaggatgtgaaaccctttacgcttgctgtcaaggacaatattgcaacctct
gagttcccgacacaatgcgcctcgcatattctctccgctcacccttcccctttcgaagct
actgtcgttcgtcaattgcgtaaacgtggtgcgaccgttgttgggaagactaacatggat
gagtttggtatgggatctcactcttcaaactcggttcatggggcagtgaggaatccttta
gctaaggatggcaatgtttccgctggtggaagctctggtggaagtgctgttgcggtgcgc
ttaggagacgcagatgtcgcattgggaacagacaccggtggttcaattcgattaccagct
gcctataccggaacggttggctacaagcccagttacggtatgatctctcgattcggcgtg
gtcccgtatgcaaactccttggacacggttggcttcatggccaatgatgtcaagcctata
catgaccttgtgttcaagaccaaaatgcatgaggagcatgattccgaagatccaacgtca
ctaccttctacgtctcggagacgatgcgccgaaacgataccatccgctcttcccgatctt
tcgaagctgaatattggtgttcccctcgagtacaacatcgatgagcttgatccttccatt
cgcgccgcttgggtatctgctgcttctagtatggaggcacagggtgcgacactggtaccc
atctcactaccatccaccagagaagctctttgcgcttattacgtccttgcccctgcggaa
gcctcgtcaaaccttgccaagtacgatggtgttcgctacggaaaacgtggtgaaggcagt
gatgctgtcggtgagactctttactctgatactcgtggcgagggttttggtgaagaggtc
aggcggcgaattctactgggtacctacagtctcagttccgaggctatagacaactacttt
atccaggctcaaaaggttcgtcggatggtgcaacaggacttcgatcgcgtctttcgactt
gataaccccctctacgaacccgagcaattcgaccttagcgatatggccgaggccactggt
atggaagacaagactggtcccgttcaggttgacttcatcctatgccctacagcaccaaca
tttcctcccagattagaagagattgaggagcaaagtagtgtggatgcatatatgaacgat
gttttcacagtgcccgcaagtctagcagggctaccggccgtgagtattccagccaaagtg
gagggaagtcaattcccagcgggtctgcaagttatcgggcagtattgggatgaccaaaga
gtacttcaactggcggagaagctgaagtttatggttgtatga

DBGET integrated database retrieval system