KEGG   Flavobacterium psychrophilum V3-5: IA03_05750Help
Entry
IA03_05750        CDS       T03659                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
fpv  Flavobacterium psychrophilum V3-5
Pathway
fpv00860  Porphyrin and chlorophyll metabolism
fpv01100  Metabolic pathways
fpv01110  Biosynthesis of secondary metabolites
fpv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fpv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    IA03_05750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fpv01007]
    IA03_05750
Enzymes [BR:fpv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     IA03_05750
Amino acid related enzymes [BR:fpv01007]
 Aminotransferase (transaminase)
  Class III
   IA03_05750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIG29996
UniProt: A0A075RZD3
Position
complement(1263069..1264355)
Genome map
AA seq 428 aa AA seqDB search
MLYKRSSQLFLEAEKVIPGGVNSPVRAFKSVGGTPIFAKSAKGAYVYDEDGNRFVDYINS
WGPMILGHAYEPVVTAVIEKAKSGTSFGMPTELETEIAKLAVSMVSNIDKIRFVNSGTEA
CMSAIRLARGFTKRDKIIKFAGCYHGHSDSFLIQAGSGAITFGSPNSPGVTSGTAKDTLL
ASYNDIQNVKNLFDANKNEIAAVIIEPVAGNMGCIPPQKGFLEALQQLCHENNALLIFDE
VMTGFRLAKGGAQELFNVQADIVCFGKVIGGGLPVGAFAARNEIMNYLAPLGPVYQAGTL
SGNPLAMAAGLAMLKALNENQEVFARLEEKTAYLAKGIADVLTSNNVVHTINRVGSMVSV
HFDANPVFDFETAKNGDNDTFKKFFHGLLAEGVYIAPSAYETWFISDALTYEDLDFTIRA
VDKVSKNL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttatacaaaagaagtagtcagttatttttagaagctgaaaaagtaataccaggtggg
gtaaactcgccagtaagagcatttaagtcggtaggcggaacgccaatatttgctaaaagt
gcaaaaggagcttatgtgtatgatgaagacggaaaccgattcgtagattacattaactct
tgggggcctatgattttaggccatgcttatgagcctgtggtaaccgcagtgatcgaaaaa
gcaaaatcaggaacctcttttggtatgccaacagaattagaaaccgaaattgcaaaacta
gccgtttcgatggtgtcaaatatagacaaaattcgatttgtaaattcaggaacagaagcc
tgtatgagtgccataagattggctcgtggatttacaaaaagagacaaaataattaaattt
gcaggttgttatcacggacattccgattcttttttaattcaagcaggaagcggagcaata
acttttggttcgcccaatagtccaggagtaacctcaggaacagcaaaagataccttgttg
gcaagctacaacgacattcaaaatgtaaagaacttattcgatgctaataagaacgaaata
gcagctgttattatagaaccagttgccggaaatatgggttgtattccgcctcaaaaagga
tttttagaagctttacagcagctttgtcacgaaaacaatgcgttgctaatttttgacgaa
gtcatgacagggtttcgtcttgcaaaaggtggcgctcaagaattatttaatgtacaagca
gatattgtttgttttggtaaagtaataggtggcggattgccagtaggcgcatttgctgca
agaaacgaaattatgaactatttagcgcctcttggaccagtttatcaagcaggaactttg
tctggaaatcctttagcaatggctgctgggttggctatgttgaaagctttaaacgaaaac
caagaagtttttgcaagattagaagaaaaaacagcgtatttagcaaaaggaattgcagat
gtacttacgtcaaataatgtagtacatactataaatagagtagggtctatggtttctgtt
catttcgatgctaatccagtttttgattttgaaactgccaaaaatggcgataatgatact
tttaaaaaattctttcacggattacttgcagaaggagtttatattgcaccatcggcttat
gaaacttggtttatttctgacgcattaacttatgaagatttagattttacaattcgagca
gtagataaagtttcgaaaaacttgtaa

DBGET integrated database retrieval system