KEGG   Flavobacterium psychrophilum V4-24: IA04_01365Help
Entry
IA04_01365        CDS       T03660                                 

Definition
(GenBank) fructose 1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
fpw  Flavobacterium psychrophilum V4-24
Pathway
fpw00010  Glycolysis / Gluconeogenesis
fpw00030  Pentose phosphate pathway
fpw00051  Fructose and mannose metabolism
fpw00680  Methane metabolism
fpw01100  Metabolic pathways
fpw01110  Biosynthesis of secondary metabolites
fpw01120  Microbial metabolism in diverse environments
fpw01130  Biosynthesis of antibiotics
fpw01200  Carbon metabolism
Module
fpw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IA04_01365
   00030 Pentose phosphate pathway
    IA04_01365
   00051 Fructose and mannose metabolism
    IA04_01365
  09102 Energy metabolism
   00680 Methane metabolism
    IA04_01365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpw04147]
    IA04_01365
Enzymes [BR:fpw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     IA04_01365
Exosome [BR:fpw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IA04_01365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: AIG36012
Position
complement(312571..313578)
Genome map
AA seq 335 aa AA seqDB search
MEERNKTLGEFIIENQQSFQYSSGELSRIINSIRLAAKVVNYKVNKAGLVDIVGAAGEQN
IQGEDQQKLDVYANEIFIQTLINREIVCGIASEENDDFITVAGSDNSHNNKYVVLMDPLD
GSSNIDVNVSVGTIFSVFRRITPVGTPVTIEDFLQPGINQVAAGYVIYGTSTMLVYTTGD
GVNGFTLNPAIGTFYLSHPNMKYSKDGHIYSMNEGNYVHFPQGVKNYIKYCQSEEGDRPY
TSRYIGSLVSDFHRNMIKGGIYIYPTSSKAPKGKLRLLYECSPMAFIAEQAGGKASDGYN
RIMEIQPTELHQRVPFFCGSYNMVEKAEEFMKNTK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacgcaacaaaacattaggcgagtttattatcgaaaatcaacaatcatttcag
tattcttcgggagaattatcccgaataatcaattcgattaggctggccgcaaaagtggta
aattataaggtaaacaaggcaggattggtagatattgttggtgcggcaggagagcaaaac
atacaaggtgaagatcagcaaaaattagatgtttatgctaatgaaatttttattcaaacc
ctaataaatcgtgaaatcgtttgcggaattgcttcggaagaaaatgacgatttcattaca
gttgccggatcagataacagccataataataagtatgtcgttttgatggatccccttgat
ggttcttcaaatattgatgtaaatgtttcggtaggaaccattttttcggtttttagaaga
ataacaccagtaggaaccccagtaactattgaagatttcttacaaccaggaattaatcaa
gtagcagcgggttatgttatatatggtacttctacgatgctggtttacacaactggagat
ggtgtaaacggatttacattaaacccagctattggtactttttacctttctcatcccaac
atgaaatattcgaaagacggacatatttattcgatgaatgaaggaaactatgttcatttt
ccgcaaggcgttaaaaattacatcaaatattgccaatctgaagaaggagatcgtccttat
acttcgagatacattggaagtttagtttctgattttcatagaaatatgattaaaggcgga
atatacatctacccaacgagttcgaaagcaccaaaagggaaattgcgtttactttacgaa
tgtagccctatggcttttattgcagaacaagctggcggaaaagcatctgatggttataat
cgcatcatggaaattcagcctacagaactacaccaacgtgttccttttttctgcggaagc
tataatatggtagaaaaagcagaagagtttatgaaaaacacaaaataa

DBGET integrated database retrieval system