KEGG   Francisella philomiragia O#319-067: KU46_1255Help
Entry
KU46_1255         CDS       T03619                                 

Gene name
sufS
Definition
(GenBank) cysteine desulfurase, SufS family protein
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
fpx  Francisella philomiragia O#319-067
Pathway
fpx00450  Selenocompound metabolism
fpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    KU46_1255 (sufS)
Enzymes [BR:fpx01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     KU46_1255 (sufS)
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     KU46_1255 (sufS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Aminotran_1_2 Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: AJI49617
Position
1299444..1300667
Genome map
AA seq 407 aa AA seqDB search
MYDVKKIREDFPFLSQTINDKPVVFFDTGASAQKPQIVIDAVADAYKFNYANVHRGVYEL
SQKASDKYENVRVKVQHFINAKSADEIVLTKGTTESINLLASSIGKSMVSSGDDIIVTEM
EHHANFVPWQILCEEKQLVFKVAKVEDNGELNIQNLLSLVTNKTKVIALTLCSNVLGTIN
PVKKIIQEVKKINPKTLIVVDGAQAVIHSKVDVQDLDCDFFVFSSHKLYGPTGVGVLYGK
YELLEKMPPYNYGGDMVNDVTIDKTTFALPPYKFEAGTPDIVGSIGFGEAIDYVNSVGME
NIASHEKKLLEYATNELKKIDGLKIIGEAPNKAGVITFVVDGCNAGDIGELLAIKGMCVR
TGKHCAHPLLYRMGATSTVRMSFGMYNTIDEVDLFIKALKKLISQLK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatgtgaaaaaaattcgagaagattttccatttcttagtcaaactattaacgat
aaaccagttgttttttttgatactggggcttcagctcagaagccacaaatagttattgat
gctgtggcagatgcatataaatttaactatgcaaatgtccatagaggtgtttatgagcta
agtcaaaaagcaagcgataagtatgaaaatgtgcgtgtaaaagttcaacattttataaat
gctaaatcagctgatgaaattgtattaactaaaggaactacagaatcaatcaatttatta
gcgagctctattggtaagtctatggtttctagtggtgatgatattattgttactgaaatg
gagcatcatgctaattttgtaccatggcaaatactttgtgaagagaaacagttagttttt
aaagttgcaaaagtagaagataacggtgaacttaatatacagaatcttttatctctagtt
acaaacaaaactaaagttatagcactgacattatgttcaaatgtattaggaactattaat
cctgtcaaaaagataatacaagaagtcaaaaaaattaatccaaagacattaatagttgtt
gatggggcgcaagcagtaatacactcaaaggttgacgtccaagatctagactgtgatttc
tttgtattctctagtcataaattatatggtccaactggagtaggagtcttgtatggtaaa
tacgaattgttagagaaaatgcctccgtataattatggtggagatatggttaatgatgta
acaatcgataaaacaacatttgcattaccgccgtataaattcgaagcaggaacacctgac
atagttggttctataggttttggtgaagccatagattatgttaattcagttggtatggaa
aatatcgcaagtcatgaaaaaaaattattagaatatgccacaaatgaattaaaaaaaatt
gatggtttaaaaataataggtgaagcaccaaataaggcaggtgttataacatttgtagtt
gatggttgtaatgccggagatataggagagctgttggcaatcaaagggatgtgtgttagg
acaggtaaacactgtgcacatcctctactatacagaatgggtgctacatcaacagtgcgt
atgtcatttggtatgtataatactattgatgaagtagacttatttattaaagcattgaaa
aaactaatatctcaattaaaatag

DBGET integrated database retrieval system