KEGG   Francisella philomiragia O#319-067: KU46_1276Help
Entry
KU46_1276         CDS       T03619                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fpx  Francisella philomiragia O#319-067
Pathway
fpx00260  Glycine, serine and threonine metabolism
fpx01100  Metabolic pathways
fpx01110  Biosynthesis of secondary metabolites
fpx01120  Microbial metabolism in diverse environments
fpx01130  Biosynthesis of antibiotics
fpx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fpx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KU46_1276
Enzymes [BR:fpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     KU46_1276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 Pyridoxal_deC Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AJI49641
Position
1319282..1320310
Genome map
AA seq 342 aa AA seqDB search
MFRYSFLDDYSEGCHPKIIKALEDTNLIQQLAYGNDEYSSQAKELICKHLNKDNVDIYFV
AGGTLANLICISSILKPYEAVISASSGHIALREAGAIEATGHKIISVFSDNGKLTSNDIK
EVIKNNSHAPHMAKPKLVYISNSTELGTIYTKEELQKLSEVCKQNNLLLFIDGARLGVAL
TAKDSNLSLADIAEFSDIFWIGGTKAGILFGEAIVIPNKNLAEEFGFNIKQRGALLAKGR
VLGLQFRELFSNNLFFDLANHANNMAEKLSKGIVNAGYMLLQPVESNQIFAILPNTMIKV
LQEKFTFFVMSEIDNKNSLVRLVTSWATVEEKVNEFIETIVS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtttagatatagttttcttgatgattatagtgaaggatgtcatcctaagataattaaa
gcattagaggatacaaacttaattcagcaattggcttatgggaatgatgaatattctagt
caggcaaaagagttaatatgtaaacaccttaataaagataatgtagatatatattttgtt
gctggaggaactcttgctaacttgatatgtatttcaagtattttaaagccatatgaagct
gtaatttctgctagtagtgggcatattgctttacgtgaggctggtgcaattgaagctaca
gggcataagattatttcagttttttctgataatggaaaattaacatctaatgatattaaa
gaagtgattaaaaataactctcatgctcctcatatggcaaaacctaaattagtatatatt
tctaactcaacagaattaggaactatatatacaaaagaagaattacagaagctatcagag
gtttgtaaacaaaataatttattattatttattgatggtgcaagattgggtgttgcattg
actgctaaagatagtaatttaagtttagctgatattgcagagttttcagatatattttgg
attggtgggactaaggctggaattttgtttggagaagcaatagttattccaaataaaaat
ctagctgaagagtttggttttaatattaagcaaagaggggcgctattagcaaaaggtaga
gtattaggacttcaatttagggaattattttctaataatcttttttttgatctagcaaat
catgcaaataatatggcagagaaactttctaaaggaatagttaatgctggctatatgctc
ttacaacctgtagagagcaatcaaatttttgctatattaccaaacaccatgataaaagta
cttcaggaaaaatttactttctttgtaatgagtgaaattgataataaaaattcattagta
agattagttacttcttgggctacagttgaagaaaaggtgaatgaatttattgaaactata
gttagttag

DBGET integrated database retrieval system