KEGG   Francisella philomiragia O#319-067: KU46_1654Help
Entry
KU46_1654         CDS       T03619                                 

Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
fpx  Francisella philomiragia O#319-067
Pathway
fpx00480  Glutathione metabolism
fpx00590  Arachidonic acid metabolism
fpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    KU46_1654
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KU46_1654
Enzymes [BR:fpx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     KU46_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx INT_SG_DDX_CT_C
Motif
Other DBs
NCBI-ProteinID: AJI48900
Position
complement(1693352..1693822)
Genome map
AA seq 156 aa AA seqDB search
MSIYDFKLTKNDGSEYSLPNNKVLLIVNVASKCGFTKQYKGLQHLHKLYPDLEIVAFPCN
SFGGQEPGSDEEIKSFCETNYDVTFPIMKKTKVNGKDAEPLFEYLKERAKGVLGTEAIKW
NFTKFLVSKDGETVIRYAPKTIPEDLISDIENFLKD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttatgattttaaattaactaagaatgatggctcagaatattctttacctaat
aataaggttcttttgatagttaatgttgcaagtaagtgcggatttactaagcaatataaa
ggacttcagcatttacataaattatatcctgatctagagatagtggcttttccatgtaac
tcatttggtggacaagaacctggtagtgatgaagaaatcaaaagtttttgtgaaactaac
tatgatgttacatttccaataatgaaaaagacaaaagtaaatggtaaagatgcagaacca
ttatttgaatatcttaaagaaagagcaaaaggtgtacttggtaccgaagctataaaatgg
aattttacaaaatttttagtatcaaaagatggtgagactgtcattaggtatgcacctaaa
acaattcctgaagatctaatatctgatatcgagaattttcttaaagattaa

DBGET integrated database retrieval system