KEGG   Flavobacterium psychrophilum FPG101: FPG101_02265Help
Entry
FPG101_02265      CDS       T03281                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
fpy  Flavobacterium psychrophilum FPG101
Pathway
fpy00250  Alanine, aspartate and glutamate metabolism
fpy00330  Arginine and proline metabolism
fpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FPG101_02265
   00330 Arginine and proline metabolism
    FPG101_02265
Enzymes [BR:fpy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     FPG101_02265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIN70909
Position
complement(519743..521368)
Genome map
AA seq 541 aa AA seqDB search
MLKGFFNIPKAVNEPVKTYAPNSPEKTRVLEAYKTMWNTKIDVPLYIGAEEIRTGNTKNM
TAPHDHQHIVGTYHLAEKSHVEKAIANALESRTKWANMAWEQRAAIFLKAAELIAGPYRA
KINAATMIAQSKTIHQAEIDASCELIDFLRFNVEFMTQIYQDQPASNSDMWNRVEYRPLE
GFVYAVTPFNFTAIAANLPASAALMGNVVVWKPSDSQVFSAKIIIDIFKEAGVPDGVINV
VFGDPVMITDTVLASPDFAGIHYTGSTFIFKEIWKKIGTNIHNYKTYPRIVGETGGKDFI
IAHPSANVKQVTTAITRGAFEFQGQKCSAASRAYIPQSMWQAVKEQLITDVKSMKMGSPE
DFSNFITAVIHEGSFDKLASFIDQAKKDTDAEIIVGGNYNKSKGYFVEPTVIVTTNPKYA
TMETELFGPVMTIYVYEDKNWSDTLQLIDSTSEYALTGAILSQDRYAIEEATVALQNAAG
NFYINDKPTGAVVGMQPFGGARASGTNDKAGSAQNLLRWVSPRTIKETFVTPEHYAYPFL
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaggattttttaacataccaaaagcagtaaacgaacccgtaaaaacttacgca
ccaaactctccagaaaaaacaagagttttagaagcttacaaaacaatgtggaatactaaa
atcgatgtaccattatacattggtgccgaagaaattcgtacaggaaacacaaaaaacatg
acagcaccacacgaccaccaacacatcgtgggaacctatcatttagctgaaaaatctcat
gtagaaaaagccatcgcaaacgctttagaaagcagaacaaaatgggcaaatatggcatgg
gaacaacgtgctgctattttcctaaaagcagccgaactaattgcaggaccataccgagca
aaaataaatgcggcaacaatgattgcacaatctaaaacaattcaccaagcagaaatagat
gcttcttgcgaattaatagactttttacgtttcaacgtagagtttatgacacaaatttac
caagaccaacccgcatctaattcagacatgtggaacagggtagaataccgccctttagaa
ggttttgtttacgccgttacacctttcaactttacagccattgcagcaaaccttcctgca
agcgcagcattaatgggtaatgttgtagtttggaaaccaagtgacagccaagtgttttct
gcaaaaataatcatagatatttttaaggaagctggagttccagacggagtaattaatgtt
gtatttggtgatccagttatgattaccgatacagttttagcctctccagattttgctggg
attcactacacaggatcaacatttatcttcaaagaaatttggaaaaaaattggaaccaat
attcacaattacaaaacatacccaagaattgttggagaaactggagggaaagattttatc
atcgcacacccatcggcaaacgtaaaacaagttacaactgcaattactcgtggcgctttc
gaatttcaaggacaaaaatgctcagcagcttcaagagcatatattccacaatctatgtgg
caagcagtaaaagagcaactaattaccgatgtaaaatcgatgaaaatgggttcgccagaa
gatttctctaactttattaccgcagttattcacgaaggttctttcgacaaattagctagt
tttatagaccaagctaaaaaagatacagatgcagaaattattgtgggtggaaactacaac
aaatcgaaaggatattttgtagaaccaacagttattgtaactacaaatcctaaatatgca
accatggaaaccgaactttttggtccagtcatgacaatttatgtatatgaagataaaaac
tggtctgacacattacaattaattgattcaacttcagaatacgcattaactggcgcgatc
ctaagtcaagatcgttacgctattgaagaagctacggtagctttacaaaatgctgcgggt
aatttttatattaatgataaaccaacgggagcagtagtaggaatgcaaccctttggtggg
gctcgtgcttcaggaacaaatgacaaagcaggttctgcacaaaacttattgcgttgggtt
tcgcctagaactatcaaagaaacttttgtaactccagaacattatgcttacccattttta
ggctaa

DBGET integrated database retrieval system