KEGG   Flavobacterium psychrophilum FPG101: FPG101_02300Help
Entry
FPG101_02300      CDS       T03281                                 

Definition
(GenBank) cobalt transporter
  KO
K06195  ApaG protein
Organism
fpy  Flavobacterium psychrophilum FPG101
Brite
KEGG Orthology (KO) [BR:fpy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    FPG101_02300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AIN70913
Position
complement(527600..527986)
Genome map
AA seq 128 aa AA seqDB search
MVIQTTRGIKISVLTTFEGTCFKNNKMHFAFSYHITIENHSKDSVQLITRHWEIHDALNY
LETVDGEGVIGKKPVLKPGETHTYSSGCLLCAPFGTMKGHFEMINFTTTKSFKVIVPAFK
LNALFALN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggtaattcaaaccacaagaggcatcaaaatttcggttctaacaacttttgaaggaaca
tgcttcaaaaacaacaaaatgcactttgcattcagttaccacattacaatcgaaaatcac
agcaaagactccgtacaactcataaccagacattgggaaatacacgatgccctaaattat
ctagaaaccgtagatggcgaaggcgtaataggtaaaaaaccagtgctaaaaccaggcgaa
acccatacatacagctcaggctgtttgctttgcgcaccatttggcacaatgaaaggtcat
ttcgaaatgatcaattttaccaccacaaaatcattcaaagtaatcgttccggccttcaaa
ctaaacgcactatttgcattaaattag

DBGET integrated database retrieval system