KEGG   Flavobacterium psychrophilum FPG101: FPG101_04090Help
Entry
FPG101_04090      CDS       T03281                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
fpy  Flavobacterium psychrophilum FPG101
Pathway
fpy00360  Phenylalanine metabolism
fpy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fpy00790  Folate biosynthesis
fpy01100  Metabolic pathways
fpy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fpy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    FPG101_04090
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FPG101_04090
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FPG101_04090
Enzymes [BR:fpy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     FPG101_04090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H MIX
Motif
Other DBs
NCBI-ProteinID: AIN71181
Position
896153..897907
Genome map
AA seq 584 aa AA seqDB search
MEAHFESNPLINRLPKHLKQFIKPQDYSEYTPINQAVWRYVMRKNVNYLSKVAHESYLVG
LEKTGLEINNIPNMYGMNRILKEIGWAAVAVDGFIPPNAFMEFQAYNVLVIAADIRQLEH
IEYTPAPDIIHEGAGHAPIIANPEYAEYLRRFGEIGCKAISSSRDYEMYEAVRLLSIVKE
AEGTPQAEIDAAERQVEFLQNNMGEMSEMSQIRNLHWWTVEYGLIGTIETPKIYGAGLLS
SIGESAWCMTDNVIKIPYSIDAVNQSFDITKPQPQLFVTPDFSYLSEVLEEFANKMALRT
GGLSGIQKLINSKAIGTIELSTGLQISGLFANVIEDQGKPIYVQTTGKTALSYREKELVG
HGTSYHAEGFGSPIGKLKGINLAIEDMSPRDLKAYDIYESGKVTLEFEGNIVVSGEIITG
SRNLQGEIILISFKNCTVTHGETILFQPEWGIYDMAVGKKVISAFSGPADVQSFNMITHI
PSSQTIKAKKTPERHELEGLYENVRNIREGKSTHLSLEDTFGKLLENHPKDWLLSVEIVE
LVQAKDTVLSSKIISHLESLKNSRPEVKKLISNGLELIFEKESV
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgcatttcgaaagcaacccgctgattaacagattgccaaaacatttaaaacag
tttataaagccacaagattatagcgaatatacacctataaaccaagctgtatggcgctat
gtgatgcgcaaaaatgtaaattatctgtctaaagttgctcacgaatcatatcttgtagga
ttagaaaaaacaggcttagaaataaataatatcccaaatatgtacggcatgaaccgaatt
ttaaaagaaattggttgggccgctgttgccgttgacggatttattccacccaatgcattt
atggaatttcaagcttataatgtccttgttattgctgccgatatcagacaattagaacac
atagaatacacccccgcaccagatattattcacgaaggcgcaggtcacgcacctattatt
gccaatcctgaatatgccgaatatttacgccgttttggcgaaataggttgcaaagcaatc
tcatcatcacgtgattacgaaatgtacgaagcggtgcggttattatcgatagtaaaagaa
gccgaaggtacccctcaagccgaaatcgatgctgccgaaaggcaagtagaattcttgcaa
aataatatgggcgaaatgtcagaaatgtcgcaaataagaaacttacactggtggactgtt
gagtatggtttaataggaaccatagaaacccccaaaatatatggcgcaggtttgctctca
tctattggcgaaagtgcttggtgcatgacagataatgtaattaaaatcccatattctatc
gatgcggtaaaccaaagtttcgatattacaaaaccacaacctcagctttttgtgacaccc
gatttttcgtatttaagtgaagttttagaagagtttgcaaacaaaatggctttaagaact
ggcggattatctggtattcaaaaactaattaattcgaaagccattgggacaatagagtta
agtactggattgcaaatttcgggtttatttgcaaatgttattgaagaccaagggaaacca
atctatgtacaaaccacaggaaaaacagctttatcttatagagaaaaagaattagttggt
cacggtacctcttatcatgcggaaggttttggaagcccaatagggaagctaaaaggaatt
aatctggctatcgaagatatgagtccgagagatttaaaagcttacgatatttatgaatca
ggaaaggtaacactagaatttgaaggaaatattgtagtttctggcgaaattattacaggt
tcacgcaatttgcaaggcgaaattatattaattagtttcaaaaattgtacggttactcat
ggcgaaaccattttgtttcagccagaatggggaatttatgatatggcggttggcaaaaaa
gtaatttcagctttttctggaccagcagatgtgcaaagttttaatatgattacacatatt
ccatcatctcaaacaataaaggctaaaaaaacacccgaacgtcatgagttagaaggcttg
tatgaaaatgttagaaatattcgtgaaggaaaatcgacccatttatcgctagaagatact
tttgggaaattgctcgaaaaccaccctaaagattggttgctttcggtagaaattgtagaa
ttagtacaggctaaagataccgttcttagctcaaaaataatttcacatttagaaagtttg
aagaactctagacccgaagtaaaaaaattaattagcaatggtttagaactaattttcgaa
aaagaatcggtataa

DBGET integrated database retrieval system