KEGG   Francisella philomiragia GA01-2794: LA55_205Help
Entry
LA55_205          CDS       T03620                                 

Gene name
dfrA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
fpz  Francisella philomiragia GA01-2794
Pathway
fpz00670  One carbon pool by folate
fpz00790  Folate biosynthesis
fpz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LA55_205 (dfrA)
   00670 One carbon pool by folate
    LA55_205 (dfrA)
Enzymes [BR:fpz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LA55_205 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 CheD
Motif
Other DBs
NCBI-ProteinID: AJI52837
UniProt: A0A0B6D3F0
Position
complement(209034..209531)
Genome map
AA seq 165 aa AA seqDB search
MISLIVAYDKNLGIGKENTLAWKLSEDLKNFKKITENNYIVMGRKTFESIGRPLPNRKNI
ILTRDKDYKQDKCLIINSVQEILNFAQSKPHYEIFIIGGAQIYKEFLGHADRLYVTEVNT
EMADLDAFFPQWDKSQFKRIGFREYNKDDKNQFDFTFSVYEKISI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgatttcattaatcgttgcttatgataaaaatcttggtataggtaaagaaaatactcta
gcatggaagctttctgaggatctaaaaaacttcaaaaagataactgagaataactatatc
gtaatgggtagaaaaacctttgaatcaattggtcgccccctccctaaccgtaaaaatatt
atcctaactagagataaagattataagcaggataagtgtttaataatcaatagtgttcaa
gagattctaaacttcgcgcaatcaaaaccgcattatgagatttttataattggtggcgca
caaatttacaaagagtttctaggacatgctgataggctatacgtaaccgaagtaaataca
gaaatggctgatcttgatgccttctttcctcaatgggataagtcacaattcaaaagaatt
ggctttagagaatataataaagatgataaaaatcagtttgacttcacgtttagcgtatat
gaaaaaatttctatctaa

DBGET integrated database retrieval system