KEGG   Francisella philomiragia GA01-2794: LA55_973Help
Entry
LA55_973          CDS       T03620                                 

Definition
(GenBank) hypothetical protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fpz  Francisella philomiragia GA01-2794
Pathway
fpz00520  Amino sugar and nucleotide sugar metabolism
fpz01100  Metabolic pathways
fpz01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:fpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LA55_973
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LA55_973
Enzymes [BR:fpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LA55_973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Arf
Motif
Other DBs
NCBI-ProteinID: AJI53476
UniProt: A0A0B6D3P8
Position
complement(1014199..1015866)
Genome map
AA seq 555 aa AA seqDB search
MPTNSNIRQKLGQLIMMDFRYWGEDSDNQRIPFTKTNHIVNKIFKDYNLGGFILFRENIQ
DNEQVISLLRDIQANTNTPIFFATDQEGGRVNRLQQGTSGCGNMALAATDNPSNAYTMAK
IIGDELYSLGININFAPAVDVNSNKNNPIIGVRSYSDNPSVVTDYAKNAINGYHDAKIID
CIKHFPGHGDTATDSHLGNVILDKTLEELDTTELLPFRELARNCSMIMTAHISVPALDDS
QYQSVSTSENIYVPTTLSYKIITKLLKQQMKFDGLVVSDAMDMHAIAKHFGTIEASKLAI
LAGIDILLMPVRVWSENDLYKLEELFCELENEYNQNPNFANAVDNAYINITDFKAKHKLD
ESLIFTLSHDEQLKYANQIVNCSKHQQISLDIAKQSTTVVKNSGIIPCDLNKLKNILIVD
SDNQRLADFHSELQKIVLKNNSTTIINIENINNQDIETSIENADIILLISANLREYNQIY
SYITSIKPEQTINIAALTPYDINYIDNIINYVCIYGATSMDQTNYTKTSLKINIQAALEN
IFNGNIPTGKLPVQI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcctacaaactcaaatataagacaaaagctaggtcaactaattatgatggattttcgc
tattggggtgaagattcagataatcaacgtataccttttacaaaaaccaatcatatcgtc
aataagatctttaaagattataatttaggtggttttattctctttagagagaatattcaa
gataatgagcaagttatctctctattaagagatattcaagctaacaccaatacaccaata
tttttcgctacagatcaagaaggtggtagagttaatcgcttacaacaaggtaccagtggc
tgcggtaatatggcactagctgcgacagataatcctagtaatgcttatactatggctaaa
ataattggtgatgaattatattctttaggtatcaatattaattttgctccagctgtagat
gtcaactctaacaaaaataatcctattattggtgtaaggtcttactcagataatcctagt
gtagttactgactatgccaaaaatgctataaatggttatcatgatgctaaaatcatagac
tgcatcaagcattttcctggtcatggtgatacagcaacagatagtcacttaggtaatgta
atcttagataaaactttagaagaattagatactacagaattgttaccttttagagagctt
gccagaaattgtagtatgataatgacagcacatattagtgtaccagccctagatgatagc
cagtaccaatcagtttcaacaagtgaaaatatttatgtgccaactactctttcttataag
ataataactaaattactaaaacaacaaatgaaatttgacggtctagtagtatctgatgct
atggatatgcacgctattgctaaacactttggaactattgaagcttctaaattagctatc
ttagctggtatagatattttattaatgcctgttcgagtatggtcagaaaatgatctttat
aagttagaagagcttttttgtgaactagaaaatgaatataatcaaaatcctaattttgct
aatgcagttgataatgcctacatcaatattactgatttcaaagcaaaacataaactcgat
gaaagtttaatattcacactctcacacgatgagcaattaaaatatgctaatcaaatagtt
aattgtagtaaacatcaacagatatctttagatatagctaagcaaagtacaactgtagtt
aaaaattcaggtattattccatgcgatctcaataagctaaaaaatatcttgattgtagat
agtgataaccaacgcttagcggattttcatagcgagttgcagaaaatagtgttaaaaaac
aactcaactactatcataaacattgaaaatattaataatcaagatattgaaactagtatt
gaaaatgctgatataattttgctaatctcagcaaacctgcgtgaatataatcagatttat
agttatataacttctataaagccagagcaaactataaatatcgcagcacttacaccttat
gatattaattatatagataatattattaattatgtttgtatttatggtgcgacttctatg
gatcaaacaaattatacaaagacttctttgaaaattaatattcaagcagcattagaaaat
atttttaacggtaatattccaacaggaaaattacctgttcagatttaa

DBGET integrated database retrieval system