KEGG   Frankia casuarinae: Francci3_0317Help
Entry
Francci3_0317     CDS       T00320                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
fra  Frankia casuarinae
Pathway
fra00020  Citrate cycle (TCA cycle)
fra00620  Pyruvate metabolism
fra01100  Metabolic pathways
fra01120  Microbial metabolism in diverse environments
fra01200  Carbon metabolism
fra01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Francci3_0317
   00620 Pyruvate metabolism
    Francci3_0317
Enzymes [BR:fra01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Francci3_0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp Biotin_lipoyl_2 RnfC_N GCV_H NQRA
Motif
Other DBs
NCBI-ProteinID: ABD09704
RhizoBase: Francci3_0317
UniProt: Q2JG88
Position
366037..369447
Genome map
AA seq 1136 aa AA seqDB search
MRKVLVANRSEIAVRVFRAAQELGLRTVAVYTPEDVSALHRTKASEAYEIGGPGHPVRGY
LDIDALLTVAKQAEADALHPGYGFLSESAVLADACATAGVTFVGPPPAVLRLTGDKVAAR
DAALAAGLPVLRASVPLPEGAGALAAAEEVGFPLFVKASAGGGGRGLRRVERPADLADAV
ASASREAAAAFGDGTIFLEQAVDRPRHIEVQILADAYGNIIHLYERDCSVQRRHQKVVEI
APAPQLDEAVRASICADAVRFARHVGYVNAGTVEFLLGADDRYTFMEMNPRIQVEHTVTE
EVTGVDLVAAQLRIADGESLAGLNLTQEQIVLRSTAIQCRVTTEDPSDGFRPDIGTISFY
QSPGGPGVRLDGATYPGAEVSPYFDSLLVKLTTRGNTLEKAARRARRALNEFRVRGVRTN
IDFLVRLLADPGFLAGGVSTSFIDERPELLAPGKGADPTSRLLARLAESTVNGFPRPAVA
LTDPRELLPPAPAQVAASGGTASGGTQPPAGSRQLLTELGPAGWAAWLRAQEALAVTDTT
LRDAHQSLLATRLRSFDILAAAPSYAALTPNLLSLEAWGGATYDVALRFLAEDPWERLAA
LRQAAPNICLQMLLRGRNAVGYTPYPDDVVRAFVAEAAATGVDIFRIFDALNDIEQMRPA
IEAVLGTGAIAEGTLCYTGDLSDPAERIYTLDYYLRLAEELVETGVHVLAVKDMAGLLRP
AAAATLVTALRERFDRPVHLHTHDTAGGQLATLLAASAAGVDAVDAAAAPMSGGTSQVNM
SALVAATDHTPRATGIALSALSAMEPYWEAVRDLYAPFEAGLRAPTGAVYRHEIPGGQLT
NLRQQAIALGLGDRWAEVTECYAIANELLGKPIKVTPTSKVVGDLALFIAGGSVDVDRLR
AHPEEFDLPASVLGYLAGELGTPPAGFAEPFRERALAGRRPSPPSVDLDAADADELSFPG
ARRVALSRLLFPGPWKDYLRAVDAYGDSSVVPTDGFLYGLRPGVPLTVTLEPGVEIIVEL
ETLSEPDDSAMRTLYLRVNGQPRPVRVRDASITATTTAARRADAADPNQVGAGLPGIVTF
SVAVGDTVTKGQRLAVVEAMKMEAAVTSPVGGTVVELVRSSGDSVEVGDLLLTLRS
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaaggtactggttgcaaatcgtagcgagatcgccgtccgtgttttccgagccgct
caggaactgggcctgcgcacggtggcggtctacacgcccgaagacgtttccgcgctgcac
cggacaaaggcgtccgaggcctacgagatcggtggccccgggcacccggtgcgcggatac
ctggacatcgatgccctgctcaccgtggccaagcaggcggaggccgacgcgctgcacccc
ggctacggcttcctgtcggagtcggcggtgctcgccgatgcgtgcgccaccgccggcgtc
accttcgtcggaccgcccccggcggtcctgcggctgaccggagacaaggtcgccgcccgg
gacgccgcgctggccgccgggctgccggtgctgcgcgcctcggtgccgctgccggagggc
gccggggcgctcgccgccgccgaggaggtcggcttcccgctgttcgtcaaggcctccgcc
ggtggtggggggcgcggcctgcggcgggtggaacgccccgccgacctcgccgacgcggtg
gcgagcgcgtcccgggaggccgccgccgccttcggggacggcacgatcttcctggagcag
gcggtggaccggccgcgccacatcgaggtccagatcctggccgacgcctacggcaacatc
atccatctgtacgagcgggactgctcggtgcagcgccggcaccagaaggtcgtggagatc
gccccggcgccgcagctcgacgaggcggtccgggcgagcatctgcgccgacgcggtgcgg
ttcgcccggcatgtcggctatgtcaatgcgggcacggtcgagtttcttctcggcgccgac
gaccggtacacgttcatggagatgaatccccggatccaggtcgagcacacggtcaccgag
gaggtcaccggggttgatctggtcgcggcgcagctgcggatcgctgatggggagagcctg
gccggcctcaacctcacccaggagcagatcgtcctgcgcagcaccgccatccagtgccgg
gtcaccaccgaggatccctcggatggcttccggcccgacatcgggacgatcagcttctac
cagtcacccggcggtccgggggtgcgcctcgacggcgccacgtacccgggggccgaagtc
agcccgtacttcgactcgttgctggtgaagctgacgacccggggtaacacgctggagaag
gcggcgcggcgcgcccggcgggcgctgaacgagttccgggtccgcggggtgcgcacgaac
atcgacttcctggtgcggctcctcgctgaccccggcttcctcgccggcggggtgagcacg
tcgttcatcgatgaacggccggagctgctcgctcccggcaagggggcggacccgaccagc
cggctgctggctcgcctcgccgagagcacggtgaacggattcccgcgcccggcggtcgcc
ctgaccgacccccgggagttgctgccgcccgcgcccgcgcaggtggcggcgtccggcggc
acggcgtccggcggcacgcagccgccggcgggatcccggcagctgctgacggagctcggg
ccggcgggctgggcggcgtggctgcgcgcccaggaggcgctggccgtcaccgacaccacc
ctgcgtgacgcccaccagtcgctgctggccacgaggctgcgcagcttcgacatcctggcg
gccgccccgtcgtacgccgcgctgacgccgaacctgctgagcctggaggcctggggcggg
gcgacctacgatgtcgcgctgcgctttctcgcggaggatccgtgggagcggctcgccgcg
ctgcgccaggccgcgccgaacatctgcctgcagatgctgctgcgggggcgcaacgcggtc
gggtacaccccctacccggacgacgtcgtccgggcgttcgtcgccgaggccgcggcgacc
ggcgtcgacatcttccggatcttcgatgcgctgaacgacatcgagcagatgcgcccggcg
atcgaggcggtgctcggtaccggggcgatcgccgaagggacgctctgctacaccggtgac
ctctccgacccggcggagcggatctacaccctcgactactacctgcgcctcgccgaagag
ctcgtcgagacgggtgtgcatgtgcttgccgtgaaggacatggcgggactgctgcgcccg
gcggcggcggccacgctggtgacggccctgcgggagcgtttcgaccggcccgtccacctg
catacccacgacaccgcgggcggccagctcgccaccctgctcgcggcgtccgcggccggg
gtggacgcggtggacgccgccgccgcgccgatgtccggcggcaccagccaggtcaacatg
tccgcgctggtggcggcgaccgaccacactccccgggcgaccggcatcgcgctgtccgcg
ctgtccgcgatggagccgtactgggaggctgtgcgcgacctctacgccccgttcgaggcg
gggctgcgggccccgaccggggccgtgtaccggcacgagattcccggcggccagctgacg
aacctgcgtcagcaggcgatcgcgctgggactgggggaccggtgggccgaggtcaccgag
tgctacgcgatcgccaacgagctgctcggcaagcccatcaaggtgacgccgaccagcaag
gtcgtcggtgacctggctctgttcatcgccggcggatccgtcgacgtggaccggttgcgt
gcgcatcccgaggagttcgacctgccggccagcgtgctcggctacctcgcgggtgaactc
ggcacgccgccggcaggcttcgccgaaccgttccgggaacgggcgctggccgggcgccgt
ccgtcgccgccgtccgtcgacctcgacgcggcggacgccgacgagctctccttcccgggg
gcccggcgggtggccctgtccaggctgctcttccccggcccgtggaaggactatctgcgg
gcggtggacgcctacggggactcctccgtggtcccgaccgacggctttttgtacgggctg
cggcctggcgttccgctcaccgtcaccctggagcccggggtagagatcatcgtggagctg
gagacgctctccgaaccggacgactccgcgatgcgcaccctgtacctgcgggtcaacggc
cagccccggccggtgcgggtccgggacgcgtccatcacggccaccaccacggcggcccgt
cgggcggacgccgccgatccgaaccaggtgggcgccgggctgccgggcatcgtcacgttc
agcgtcgcggtgggcgacacggtgacgaagggccagcggctggcggtggtggaggcgatg
aagatggaggccgcggtgaccagcccggtgggcgggaccgtcgtggagctcgtccgctcc
agcggcgactccgtcgaggtcggcgacctgctgcttactctgcgttcctga

DBGET integrated database retrieval system