KEGG   Frankia casuarinae: Francci3_0359Help
Entry
Francci3_0359     CDS       T00320                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
fra  Frankia casuarinae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like
Motif
Other DBs
NCBI-ProteinID: ABD09746
RhizoBase: Francci3_0359
UniProt: Q2JG46
Position
complement(418487..420382)
Genome map
AA seq 631 aa AA seqDB search
MATVPVGNRMVAGRYRLVARLGAGAMGTVWRAFDSVLETEAALKEIEFAGGVAEAERADR
VERALREARHAAKLRGHPHVVTILDVLLENGLPWIVMELVPSRSLFEVVRSDGPLPVAEV
ARIGTAVLDALVAARAHGIVHRDVKPSNVLIGTDGRVVLTDFGIATGDGDPTLTVTGVLG
TPLYMAPERLNNQPATFEADLFSLGGTLYFAVEGRPPFERDTFGAMLAAILLQPPAQAHR
AGELAAVLDGLLEKDPGRRMTPARAHELLARAAQADPPRRAAHVDELSWHPGPTARAAPS
QVPGQAPSQVPGQAPSQAPSGHVDPGAPQTGRPAAPTELTAVEQDGAVLLRWEPSTTQGA
SYRVSRVLVDPTAPGGRRERSLGITTATELFDAGVPRGVPHWHEVVTTVSGESGQLRSVP
VRTPTRTLFPPVTALRASMIDDAVALSWRPVPGQGCIVIERTFAETSPLSGAKRRFRGSD
GYFLDQDTAPGAIYRYQVWVAGADASDSLVAPSGAAEVLVRVVARPRAVVDLEARSTLGG
TVLRWTTVPGAIVRIYVTEVPEQAGLVGTGPFGPADHEVGVGSLEGRARLVGESRRGRLV
DRNPAGVVVYTPVTITEDRAVIGAAVTHHAP
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
gtggctaccgttccggtaggcaaccgtatggtggcgggccgataccgactcgtcgcgcgg
ctgggtgcgggtgcgatggggacggtgtggcgtgccttcgactccgtgctggagaccgag
gcggccctcaaggagatcgagttcgccggcggagtcgccgaggccgaacgcgcagaccgg
gtcgaacgcgccctgcgggaggcgcgccatgcggccaagcttcgcggccatccgcatgtc
gtcaccatcctcgacgtgctcctggaaaacggcctgccctggatcgtgatggagctcgtg
ccgtcccggtccctgttcgaggtggtccggtccgacgggcccctgcccgttgccgaggtc
gcccggatcgggaccgcggtgctcgatgccctcgtcgcggcacgggcgcatggcatcgtt
caccgtgacgtcaagccgtcgaacgtcctgatcgggaccgatggacgggtcgtgctcacc
gacttcggcatcgccaccggcgacggcgacccgaccctcaccgtcaccggtgtcctcggg
acccccctctacatggcgccggagcggctgaacaaccagcccgccaccttcgaggcggac
ctgttcagcctgggcggcacgctgtacttcgccgtcgagggccggccgccgttcgagcgg
gacacgttcggcgcgatgctcgcggccatcctgctgcagccgcccgcccaggcgcaccgg
gccggcgagctggccgcggtgctcgacggcctgttggagaaggaccccggccggcggatg
accccggcccgggcgcacgagctgctcgcccgggcggcccaggccgatccgccgcgtcgg
gcggcccacgttgacgagctgtcctggcatccagggcccaccgccagagcggcgcccagc
caggtgcccggccaggcgcccagccaggtgcccggccaggcgcccagccaggcgcccagc
ggacacgtcgatcccggcgcgccgcagaccggccgtcctgccgccccgacggagctcacc
gcggtggagcaggacggcgcggtcctgctccgatgggaaccatcgaccacgcagggcgcc
tcctaccgggtgtcgcgtgttcttgtcgaccccacggcccccggcggccgccgcgaacgc
agcctgggcatcaccacggccaccgagctgttcgacgccggcgtgcccaggggcgtcccg
cactggcacgaggtggtcaccacggtgtccggcgaatccggccagctgcggtccgtaccg
gtccgcaccccgacccgcacgctcttcccgcccgtcacggcgctgcgggcgagcatgatc
gacgacgcggtcgcgctgtcctggcgaccggttccggggcagggctgcatcgtcatcgaa
cggaccttcgccgagacctccccgctgtcgggcgcgaagcgccggttccgcggatccgac
ggctatttcctcgaccaggacaccgcgcccggcgcgatctaccgctaccaggtgtgggtc
gccggagcggacgcctcggatagtctcgtcgccccgtcgggtgccgcggaggtactggtg
cgggtcgtcgcacggccgcgcgcggtggtggatctggaggcccgttccaccctgggcggc
accgtcctgcgctggacgaccgtgcccggagcgatcgtgcggatctacgtgaccgaggtt
cccgagcaggccgggctggtcggtaccggcccgttcggcccggccgaccacgaggtgggc
gtggggtcgctggagggccgggcccgtcttgtcggggagagccgccgcggacgtctcgtc
gaccgcaatcccgccggcgtggtggtgtacacgccggtcaccatcaccgaggaccgcgcg
gtgatcggcgcggccgtcacccatcacgctccgtaa

DBGET integrated database retrieval system