KEGG   Frankia casuarinae: Francci3_0491Help
Entry
Francci3_0491     CDS       T00320                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
fra  Frankia casuarinae
Pathway
fra00450  Selenocompound metabolism
fra00970  Aminoacyl-tRNA biosynthesis
fra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Francci3_0491
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Francci3_0491
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fra01007]
    Francci3_0491
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fra03016]
    Francci3_0491
Enzymes [BR:fra01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Francci3_0491
Amino acid related enzymes [BR:fra01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Francci3_0491
Transfer RNA biogenesis [BR:fra03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Francci3_0491
 Prokaryotic type
   Other AARSs
    Francci3_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ABD09877
RhizoBase: Francci3_0491
UniProt: Q2JFR5
Position
complement(575893..577458)
Genome map
AA seq 521 aa AA seqDB search
MRLLPGRKDSHQMGRYFVTTAIPYVNGKPHVGHALELIETDAYARHLRQRGHEVRFQTGT
DDNALKNVQAAEAEGITPAEYVERVATGFVGLRGPLGLSFDDFIKTSTDPRHRPGVEKLW
SACADRGDFYRKTYAGLYCVGCELFYQPDELVDGRCPEHGTVPDLVEESNWFFRLGRYQD
QLHALISTDRLRIEPAARKREVLSFIEAGLEDFSASRSMSRARGWGIPVPGDPEQVIYVW
FDALGNYITAPGYGNDDDSFQYWWNDADRRVHVIGKGIIRFHAVYWPAMLLSAGVRLPDT
IFVHEYLTADSMKISKSAGNAEDPADIVAAFNTDALRWWMLRDVARAGDTDYTTERLVTR
ANEDLANNIGNLVNRTVSMVKRYRDGLIPPLALDNPAAAKLRAVRDETPRTIDDAFAAFD
FRRAAEVITRIGDEGNRYVEAARPWELAKAERKEGASRDALDAVLAELVATCRELAEHLA
PFLPDSAPRIAAQCGDGGSRVAGPSPVFPRLEAPPAEPATT
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctgctaccggggcggaaggactcacaccagatgggccgctacttcgtgacgacg
gcgattccgtacgtcaacggcaagccgcacgtaggtcacgctctcgaactgatcgagacc
gatgcgtacgcacgtcatcttcgtcagcgcggccacgaggtccggttccagaccggcacc
gacgacaacgccctgaagaacgtccaggcggccgaggccgaggggattacacccgccgag
tacgtcgagcgggtcgccaccgggttcgtgggccttcgcggtccgttgggcctctcgttc
gacgatttcatcaagacgagcacggacccccgtcatcggccgggagtcgagaagctgtgg
tcggcctgcgccgaccgcggggacttctaccgcaagacctacgccggtctgtattgcgtg
ggatgcgagctgttctaccagcccgacgagctggtggacggccgctgtccggaacacggg
accgttcccgacctggtggaggagagcaactggttcttccggttgggccgctatcaggac
cagctccacgcgctcatctccaccgaccggctgcgcatcgagcccgccgcccgcaagcgg
gaggtgctgtccttcatcgaggccggtctggaggacttcagcgcgtcgcggagcatgagc
cgggcccgcggctggggtattccggtccccggcgaccccgagcaggtcatctacgtgtgg
ttcgacgcgctcgggaactacatcaccgcccccgggtacggcaacgacgacgacagcttc
cagtactggtggaacgacgccgacaggcgagtgcacgtcatcggcaagggcatcatccgc
tttcacgccgtctactggccggcgatgctgctctcggccggggtgcgcctgcccgacacc
atcttcgtgcacgagtatctcaccgccgacagcatgaagatcagcaagtcggctggcaac
gccgaggatcccgccgacatcgtcgccgccttcaacaccgacgcgctgcggtggtggatg
ctgcgcgacgtcgcccgagccggcgacaccgactacacgaccgaacggctcgtgacccgc
gcgaacgaagacctcgccaacaacatcggcaacctggtcaaccggaccgtgtcgatggtg
aagcggtaccgggacgggctcattcccccactcgccctcgacaatcccgcggccgccaag
ctgcgggcagtgcgcgacgagaccccccggacgatcgacgacgccttcgccgccttcgac
ttccgccgggcggccgaggtcatcacgaggatcggcgacgagggtaaccgctacgtggag
gctgcccggccctgggagctcgcgaaggcggagcgcaaggagggagcgtcgcgcgacgcc
ctcgacgcagtcctcgccgaactggtcgccacgtgccgggagctggcggagcacctcgcg
cccttcctgcctgactcggcaccgcgcatcgccgcgcagtgcggcgacggcgggtcgcgg
gtcgcgggtcccagcccggtgttcccgcgcctggaggccccgccggccgaaccggccacg
acctga

DBGET integrated database retrieval system