KEGG   Frankia sp. CcI3: Francci3_0528Help
Entry
Francci3_0528     CDS       T00320                                 

Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
fra  Frankia sp. CcI3
Pathway
fra00860  Porphyrin and chlorophyll metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Francci3_0528
Enzymes [BR:fra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Francci3_0528
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Francci3_0528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: ABD09912
RhizoBase: Francci3_0528
UniProt: Q2JFN0
Position
613123..614649
Genome map
AA seq 508 aa AA seqDB search
MTDGRSVGEVWLVGAGPGDPGLLTVRGREVLANADVVVTDRLAAAVLLGAAPAGAEIIHV
GKSPAAPSWTQEEINAVLVDRARAGARVVRLKGGDPYMLGRGSEEAQACAAAGVACTVVP
GVTSALAVPACAGIPVTHRGLAQEVAIVSGHLPPGHPESTVDWAALAASRATIVILMGVA
RLMDIADALLTGGRPEATPVAVIERGATPAQRVLRTTLDALAIDAIAAGVRSPAVIVVGE
VAARRDALALEAGPLTGIRVLVARTRPRPGLLARRLRQLGADAVETVVARPAPVEDAGAA
LVAALPGAGGLLLADADEVAAVVTLLRRAGTDVRALAGLTLVAAREDAAEALDGLGLASV
PVAELSTDPLSADPSSTGPAGPAGPTGSSRVLIAGAADPPDAVCSLRRVPLLTDVTAEPD
PRIAEELRHGDFDVAVFASSTAARGTAEIYGPLPPDLLIAAMGRRSALACAAAGMRVDIV
PTEPGVHPLAAAVADFVVTSRSTGSPGG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacgggcgaagtgtgggtgaggtctggctggtcggcgcgggtccgggcgatccc
ggtctgctcaccgttcgcggccgtgaggtgctggcgaacgcggacgtcgtggtcaccgac
cggctcgccgcggccgtcctcctcggcgccgccccggccggcgccgagatcatccacgtg
ggcaagagcccggccgccccgtcgtggacccaggaggagatcaacgcggtcctcgtcgac
cgggcgcgcgccggtgcgcgcgtcgtccgcctcaagggcggcgatccctacatgctcggg
cgaggcagcgaggaggcgcaggcctgcgccgcggcgggggtcgcgtgcaccgtcgtgccc
ggcgtcacctcggcgctggccgtacccgcctgtgccggcatcccggtcacccatcgtggt
ctcgcgcaggaagttgccatcgtctcggggcacctgccacccggccatccggagtcgacg
gtggactgggccgctctcgcggcctcccgggcgaccatcgtcatcctgatgggggtggcg
cgtctcatggacatcgccgacgcgctgctcaccggcggtcgccccgaggcgacgccggtc
gcggtcatcgagcgcggggcgaccccggcgcagcgggtcctgcggaccaccctggacgcg
ctggcgatcgacgcgatcgcggccggtgtgcggtctcccgcggtgatcgtggtcggagag
gtcgcggcgcgccgggacgcgctggccttggaggcggggccgctcaccgggatccgggta
ctcgtggcccgtacccggccgcggccgggtctgctggctcgccggctgcggcagctgggc
gcggatgcggtcgagaccgtcgttgcccggcccgcgccggtcgaggacgccggtgccgcg
ctggtggcggcgctgccgggagcgggcggcctgctgctggccgatgcggacgaggtcgcc
gccgtggtgaccctgctgcgtcgagccggcaccgacgtgcgggcgttggccggcctgact
ctcgtcgcggcccgcgaggacgccgcggaagcgcttgacggcctgggcctcgcctcggtg
cccgtcgccgagctgtccacggatccgctgtccgcggatccatcgtcgaccggtcccgcc
ggtcccgccggtccgaccggctcgtcgcgggtgctgatcgccggcgcggcggacccgccg
gacgcggtgtgttccctgcgccgggtgccgctgctcaccgacgtgaccgccgagccggat
ccccggatcgccgaggagctccggcatggcgacttcgacgtcgcggtcttcgcgtcgtcc
accgccgcccgcggcaccgccgagatctacggacctctcccgcccgatctgctcatcgcg
gcgatgggtcgacgcagcgcgctggcctgcgcggcggcgggcatgcgggtggacatcgtg
cccaccgaacccggggtccatccgctcgcggccgccgtcgcggacttcgtcgtcaccagc
cggtccaccggctcgcctgggggttga

DBGET integrated database retrieval system