KEGG   Frankia sp. CcI3: Francci3_0651Help
Entry
Francci3_0651     CDS       T00320                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fra  Frankia sp. CcI3
Pathway
fra00020  Citrate cycle (TCA cycle)
fra00640  Propanoate metabolism
fra00660  C5-Branched dibasic acid metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
fra01130  Biosynthesis of antibiotics
fra01200  Carbon metabolism
Module
fra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Francci3_0651
   00640 Propanoate metabolism
    Francci3_0651
   00660 C5-Branched dibasic acid metabolism
    Francci3_0651
Enzymes [BR:fra01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Francci3_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABD10035
RhizoBase: Francci3_0651
UniProt: Q2JFA7
Position
745036..746202
Genome map
AA seq 388 aa AA seqDB search
MDLFEYQAKKLFAEHGVPVPTGKTATTPEEARAIATELGGRVVVKAQVKTGGRGKAGGVK
VADGPDDAFAKATAILGMDIKGHTVHSVLVEEASNIAEEYYASFLLDRANRTFLAMASRE
GGMEIEEVAATKPEALARIAIDPLKGVDAAKAREIAVAAKLPEAALDGASELLAKLWTVF
VKSDATLVEVNPLILTGDGRVVALDGKVSLDDNADFRHPEHEAFVDVAAVDPLEQKAKEK
GLNYVKLEGEVGIIGNGAGLVMSTLDVVTYAGEEFGGKRPANFLDIGGGASAEVMANGLS
IILGDPAVKSVFVNIFGGITSCDAVANGIVQALKIVGDVSTPLVVRLDGNNAEEGRRILA
EANLPVVKPVDTMDGAAKLAAELAAAAA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggatcttttcgaataccaggcgaagaagctgttcgccgaacatggcgtaccggtgccc
accgggaagaccgcgaccacccccgaggaggcccgcgcgatcgccaccgagctcggtggc
agggtcgtcgtcaaggcgcaggtcaagaccggaggccggggcaaggccggtggcgtcaag
gtagccgacgggccggatgacgccttcgcgaaggcgacagcgatcctcggcatggacatc
aagggccacacggtccactcggtgctcgtcgaggaagccagcaacatcgccgaggagtac
tacgcatccttcctgctggaccgggcgaaccgcaccttcctcgccatggcctcccgagag
ggcggcatggagatcgaggaggtggcggcgaccaagccggaggcgctggcccggattgcg
atcgacccgctcaagggagtcgacgcggccaaggctcgcgagatcgcggtcgcggcgaag
ctgcccgaggcggctctggacggcgcgagcgagctgctggccaagctctggaccgtgttc
gtcaagtcggacgccaccctcgtcgaggtcaacccgctgatcctcaccggtgacggccgg
gtcgtcgccctcgacggcaaggtcagcctggacgacaacgccgacttccgccacccggag
cacgaggcgttcgtcgacgtggccgcggtggacccgctggagcagaaggccaaggagaag
ggcctcaactacgtcaagctcgagggcgaggtcgggatcatcggaaacggtgccggcctg
gtcatgtccaccctcgacgtggtgacctacgccggggaggaattcggcggcaagcgcccg
gcgaacttcctcgacatcggcggcggtgcgtccgccgaggtcatggcgaacggtctgtcg
atcatccttggtgacccggcggtcaagagcgtcttcgtcaacatcttcggtggcatcacc
tcctgcgacgcggtggccaacggcatcgtgcaggccctgaagatcgtcggcgacgtcagc
accccgctggtggtgcgcctcgacggcaacaacgccgaggagggccgccgcatcctggcc
gaggcgaacctgccggtggtcaagccggtcgacacgatggacggcgcggcgaagctcgcc
gccgagctcgccgcggccgcggcctga

DBGET integrated database retrieval system