KEGG   Frankia casuarinae: Francci3_1413Help
Entry
Francci3_1413     CDS       T00320                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
fra  Frankia casuarinae
Pathway
fra00471  D-Glutamine and D-glutamate metabolism
fra00550  Peptidoglycan biosynthesis
fra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Francci3_1413
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Francci3_1413
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fra01011]
    Francci3_1413
Enzymes [BR:fra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Francci3_1413
Peptidoglycan biosynthesis and degradation proteins [BR:fra01011]
 Precursor biosynthesis
  Amino acid ligase
   Francci3_1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Pyr_redox FAD_binding_3 AlaDh_PNT_C NAD_binding_8 DAO Amino_oxidase Mur_ligase NAD_binding_7 LSDAT_prok HI0933_like Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ABD10790
RhizoBase: Francci3_1413
UniProt: Q2JD52
Position
1702379..1703794
Genome map
AA seq 471 aa AA seqDB search
MTGDGQGPGDGQGPGNLTTSISWAGLPVLVVGIGVSGLAAARALLARGARVRVVDAGDSP
RHQGAAATLRALGAEVNLGGLPAGPGDSALVVTSPGVPPTAPLITGAAGAGIPVWGEVEL
AWRWRGGSRWLAVTGTNGKTTTTEMLGAMLAAGGRRSTTAGNIGTPIVDAVAAEPPYETL
AVELSSFQLHYTHTMAPLAAAVLNVAPDHLDWHGGAAAYAAAKAGIWRRPGTTAIGNADD
ATSADLLAAAPGRRVLFGLDPAARPRPGLTVVDGHLVDDAFGGGRLVAVRDLVLTSPHMI
SNALAAAALARAEGVGPAAIGAALVAFRPGAHRNAEVAVIDGVRWVDDSKATNPHAAAAS
LAGYPSVVWIAGGLNKGLAFDDLVRDARRVLRAAVLIGRCADEIAAALARHAPDVPVERA
DGMDDAVKAAAAFATTGDTVLLAPAAASMDMFRDYAARGDLFAAAVRAREG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgacggtcagggcccgggcgacggtcagggcccaggcaacctcacgacctcg
atctcctgggcgggcctgcccgtgctggtcgtcgggatcggggtctccgggctcgccgcg
gcccgggcgctgcttgcccgcggtgcgcgggtccgggtcgtcgacgccggcgactcccca
cgtcaccagggtgcggccgcgacgctgcgggcgctcggggccgaggtgaacctcggcggc
ctgccggccggccccggggacagcgccctcgtcgtcacctcgcccggcgtcccgccgacg
gccccgctgatcaccggggcggccggcgccgggatcccggtctggggggaggtggagctc
gcctggcggtggcggggtgggagccggtggctcgccgtcacgggaacgaacggcaagacg
acgaccaccgagatgctcggcgcgatgctcgccgccggtggccggcgatccaccaccgcc
gggaacatcgggaccccgatcgtggacgcggttgccgccgagccgccctacgagaccctc
gcggtggaactgtccagcttccagctccattacacccacaccatggcccccctcgccgcg
gccgtgctcaacgtcgcccccgaccatctcgactggcacgggggcgcggcggcctatgcg
gcagcgaaggcggggatctggcgtcgtcccgggacgaccgcgatcggcaacgccgacgac
gcaaccagcgcggacctgctcgccgccgctccggggcggcgggtcctgttcggtctcgac
ccggcggcccggccgcggcccggcctgaccgtcgtcgacggccacctcgtcgacgacgcc
ttcggtggcgggcggctggtcgccgtccgtgacctcgtgctgacaagtccgcacatgatc
tccaatgcgctggccgccgccgcgcttgcccgcgccgagggcgttggcccggccgcgatc
ggcgcggcgctcgtcgctttccggcccggcgcccaccgcaacgccgaggtggccgtcatc
gacggggtccgctgggtggatgacagcaaggcgacgaacccacacgccgccgccgcgtcg
ctggccggctacccctcggtggtgtggatcgcgggcggcctcaacaagggcctcgccttc
gacgatctcgtccgcgacgcgcgccgggtgctgcgcgccgcggtcctcatcgggcgctgc
gccgatgagatcgccgccgctctcgcccgacacgcccccgatgtccccgtggaacgggct
gacggcatggacgatgcggtgaaggctgcggcggcgttcgcgaccaccggtgacactgtg
ctcttggcgccggccgcggcctcgatggacatgttccgggactacgcggcgcgcggagat
ctgttcgcggcggcggtccgcgcacgagaggggtaa

DBGET integrated database retrieval system