KEGG   Frankia casuarinae: Francci3_1647Help
Entry
Francci3_1647     CDS       T00320                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
fra  Frankia casuarinae
Pathway
fra00030  Pentose phosphate pathway
fra00480  Glutathione metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
fra01130  Biosynthesis of antibiotics
fra01200  Carbon metabolism
Module
fra_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
fra_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Francci3_1647
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Francci3_1647
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fra04147]
    Francci3_1647
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Francci3_1647
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Francci3_1647
Exosome [BR:fra04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Francci3_1647
  Exosomal proteins of colorectal cancer cells
   Francci3_1647
  Exosomal proteins of bladder cancer cells
   Francci3_1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ABD11023
RhizoBase: Francci3_1647
UniProt: Q2JCG9
Position
complement(1980051..1981583)
Genome map
AA seq 510 aa AA seqDB search
MAPTVSTNPLRDPRDRRLPRLPDASALVVFGATGDLARKKLIPAVYDLAHRGLLPPGFVL
LGFARRDWPDEDFAEFARQAAEKGARTPFRAEVWDRLAGSVRFLPGSFDDDAAFDRLART
LESLEHSHGIRGNAAFYLSIPPSAFPVVLKQMQRTGLSSAAGSGGWRRVVVEKPFGHDLE
SARQLNALVDDVFTPSGVFRIDHYLGKETVQNLFALRFANTLFEPIWNSQFVDSVQITMA
EDVGIGTRAGFYDETGAARDVLQNHLLQLLALTAMEEPVSFGAETIRTEKLKVLRAVSLP
MDLTRYAVRGQYEQGWLAGERVPGYLDEQDIPAQSRTETFSAVRLGIETRRWAGVPFYLR
TGKRLPRRVTEVAIFFKKAPHLPFDETATTELGNNQLVIRVQPDEGVTLKFGSKVPGSAM
EVRDVAMDFLFGEAFTEALPEAYERLILDVLLGDATLFPNNAEVEESWRIVDPLERHWAG
TTPHRYRAGTWGPAAADEMLAHDGRRWRRP
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcccacggtgagtaccaacccgctgcgggacccacgtgaccgcagactgccgcgc
ctgccggacgcgagcgccctggtggtgttcggcgctaccggcgacctggcccgcaagaag
ctgatccccgccgtctacgacctggcccaccgcggcctgctgccgccgggtttcgtcctg
ctcgggttcgcccgccgggactggcccgacgaggacttcgccgagttcgcccggcaggcc
gccgagaagggcgcccgcacccccttccgtgcagaggtctgggaccggctggcgggctcc
gtgcggttcctgccagggtccttcgacgacgacgccgcgttcgaccggctcgcccgcacg
ctggagagcctggagcactcccacggtatccgtggcaacgcggcgttctacctgtcgatc
ccgccgtcggccttcccggtcgtgctcaagcagatgcagcgcaccgggctctcctcggcc
gcgggttcgggcggctggcgccgggtcgtcgtcgagaaaccgttcggtcacgacctggag
tcggcccggcagctcaacgcgctcgtcgacgacgtcttcaccccgtccggggtgttccgc
atcgaccactacctgggcaaggagacggtccagaacctcttcgcgctgcgcttcgccaac
acgctgttcgaaccgatctggaactcccagttcgtcgattcggtgcagatcaccatggcc
gaggacgtcgggatcggcacccgggccggcttctacgacgagacgggcgccgctcgggac
gtgctccagaaccacctgttgcagctgctcgccctgaccgcgatggaggagccggtcagc
ttcggcgcggagaccatccgcaccgagaagctgaaggtgctccgcgcggtgtcgctgccc
atggacctcactcgctacgcggtaagggggcagtacgagcagggctggctcgccggggag
cgggtcccgggctacctcgacgaacaggacatccctgcgcagtcgcggacggagaccttc
tcggcggtgcgcctcggcatcgagacgcgccggtgggccggggtgccgttctacctgcgg
accggcaagcggctgccacggcgggtcaccgaggtcgccatcttcttcaagaaggcgccg
cacctgccattcgacgagaccgccaccaccgagctcggcaacaaccagctggtcatccgg
gtgcagcccgacgagggggtcacgctcaagttcggctccaaggtccccggctcggcgatg
gaggtccgggacgtcgcgatggacttcctgttcggtgaggcgttcaccgaggcgctgccg
gaggcctacgaacggctgatcctcgacgtgctgctcggcgacgcgacgctgttcccgaac
aacgcggaggtcgaggagtcctggcggatcgtcgatccgctggagcggcactgggcgggc
accaccccgcaccgctaccgggccggcacctggggtccggctgccgccgacgagatgctc
gcccacgacggtcgccggtggcggcggccatga

DBGET integrated database retrieval system