KEGG   Frankia casuarinae: Francci3_1667
Entry
Francci3_1667     CDS       T00320                                 

Definition
(GenBank) Glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
fra  Frankia casuarinae
Pathway
fra00500  Starch and sucrose metabolism
fra00520  Amino sugar and nucleotide sugar metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
Module
fra_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Francci3_1667
   00520 Amino sugar and nucleotide sugar metabolism
    Francci3_1667
Enzymes [BR:fra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     Francci3_1667
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Fucokinase
Other DBs
NCBI-ProteinID: ABD11043
RhizoBase: Francci3_1667
UniProt: Q2JCE9
Position
2000815..2002053
AA seq 412 aa
MPSPRVLGLVLAGGAGRRLAPLTADRAKPAVPFGGLYRLIDFVLSNLVNAGYLRIAVLTQ
YKSHSLDRHITTTWRMSNLLGNYVTPVPAQQRLGPRWFAGSADAIHQSLNLVYDDAPDIV
VVFGADHVYRMDPRQMVAQHLDSGAGVTVAGLRVPRSEGRAFGVIQTAPDGRTIEAFLEK
PADPPGLPGSPEETFASMGNYVFSTDVLIDALRKDAADEDSVHDMGGNIIPMLVAQRAAA
VYDFAGNVVPGTTVRDRGYWRDVGTVDSYFEAQMDLCALDPVFNLYNREWPILTSIPSLP
PAKFVHDGLQRTGTAVNSIVSNGVIISGGTVRSSVLSPGVRVSSWAEVDHTVLMDNVLVG
RGAVVRDAILDKNVHVPAGAQVGVDKDRDRARGYTVSEQGITVVGKGVTIAD
NT seq 1239 nt   +upstreamnt  +downstreamnt
gtgccgagcccgcgggtcctcggtctggtgctggccgggggtgccggacggcggctggcg
ccgctgaccgcggaccgggcgaagcccgccgtcccctttggcgggctgtaccgcctgatc
gacttcgtgctgtccaacctggtgaacgcgggctacctgcgcatcgcggtcctgacccag
tacaagagccacagtctcgaccggcacatcacgacgacatggcggatgagcaacctgctc
ggcaactacgtcacgccggtgccggcgcagcagcggctggggccgcgatggttcgccggc
agcgccgacgccatccaccagtcgctgaacctcgtctacgacgacgccccggacatcgtc
gtggtcttcggcgcggaccatgtgtaccggatggacccgcggcagatggtcgcccagcat
ctcgacagcggagccggcgtcaccgtcgccgggctgcgggtgccgagatccgagggcagg
gcgttcggggtcatccagacggcgcccgacggccgcacgatcgaggcgttcctggagaag
cccgccgatccgccgggtctgccgggtagccccgaggagacgttcgcctcgatgggtaac
tacgtcttctcgacggacgtgctgatcgacgccctgcgcaaggacgccgcggacgaggac
agcgtccacgacatgggcgggaacatcatcccgatgctcgtggcccagcgggcggcggcg
gtgtacgacttcgccggcaacgtcgtcccgggcacgacggtgcgtgaccgcggctactgg
cgcgacgtcggcaccgtcgactcgtacttcgaggcgcagatggatctgtgtgcgctcgac
ccggtgttcaacctctacaaccgggagtggccgatcctcaccagcatcccctcgctgcca
ccggcgaagttcgtgcacgacggcctgcagcgcaccggcacggccgtgaacagcatcgtc
agcaatggagtcatcatctccgggggcacggtgcgctcgtcggtgctgtccccgggagtg
cgggtgagctcctgggccgaggtcgaccacacggtgctcatggacaacgtgctcgtcggc
cggggggccgtcgtccgcgacgccatcctggacaagaacgtgcacgtgccggcgggcgcc
caggtcggggtggacaaggaccgggaccgcgcccgcggctacaccgtgagcgagcagggc
atcaccgtcgtcggcaagggcgtcacgatcgccgactga

DBGET integrated database retrieval system