KEGG   Frankia casuarinae: Francci3_2203Help
Entry
Francci3_2203     CDS       T00320                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
fra  Frankia casuarinae
Pathway
fra00020  Citrate cycle (TCA cycle)
fra00480  Glutathione metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
fra01200  Carbon metabolism
fra01210  2-Oxocarboxylic acid metabolism
fra01230  Biosynthesis of amino acids
Module
fra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fra_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Francci3_2203
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Francci3_2203
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Francci3_2203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ABD11572
RhizoBase: Francci3_2203
UniProt: Q2JAX0
Position
2575017..2577236
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVQAYAATAGVSVDSRDISLAGRIIASFPEDLEEAQ
RIEDALAELGELARTPEANIIKLPNISASIPQLKAAIVELQKRGYALPDYPDDPKTDEER
EIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYARTHPHRMGAWTPDSKTNVATMGAGD
FRSTEKSTIIAAAGTLRIELAGDDGSTTVLLPSLPVLAGEVVDAAVLRVAALREFLTAQI
ARAKAEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFATHGATLAAAGLSPNDGLGGI
LKGLESLPEGAQIKASFAAELAEGPALAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGREADTLAVLPDSSYAGIYQVAIDDCRAHGAYDPATMGSVANVGLMAQKAEEYGS
HDKTFEIPTTGTVRIVDQAGTVVLEQAVAAGDIFRACQTKDAPIRDWVKLAVARARATGD
PAVFWLDENRAHDARLIEKVRAYLPGHDTSGLRIEIKAPVDAIAFSLERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQLLRENYLRWD
SLGEFLALAASFEQFARTTGNARAQVLADTLDRATATFLNEDKSPSRRLGGLDNRGSHFY
LALYWAQELAAQIGDPRLAEAFAGLAKTLADQEKAIVDELIAVQGSPADIGGYYQPDPVK
AAAVMRPSKIFNEAIASLG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacacacactgacgaggctccggccctggcgacgtac
tcgttcctgcccgtggtccaggcgtacgccgcgacggccggggttagtgtcgacagccgc
gacatctccctggcggggcggatcatcgccagtttccccgaggatctcgaggaggcccag
cgcatcgaggacgcgctcgccgagctcggtgagctggccaggacgcccgaggcgaacatc
atcaagctgccgaacatctcggcttcgattccgcagctgaaggcggcgatcgtcgagctg
cagaagcggggctatgcgctgccggactacccggacgacccgaagaccgacgaggagcgg
gagatccgcgcccgttatgacaaggtgaagggcagcgccgtcaacccggtgctgcgcgag
ggcaactccgaccgccgcgccccggcctcggtgaagaactacgcccggacccacccgcac
cggatgggcgcgtggacacccgactcgaagacgaacgtcgccacgatgggcgccggcgac
ttccgctccaccgagaagtccacgatcatcgccgcggccggcacgctgcgcatcgagctt
gcgggtgacgacggcagcaccaccgtcctgctcccgtccctgccggtgctggcgggcgag
gtagtggacgcggccgtcctgcgggtggccgcgctgcgcgagttcctcaccgcgcagatc
gcccgggccaaggccgagggcgtgctgttttcggtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtggtacgggccttcttcccgaagacgttcgcc
acccacggcgcgacgctcgccgcggccggcctgtccccgaacgacgggctcggcggtatc
ctcaagggcctggaatcgctgcccgagggcgcgcagatcaaggcctccttcgccgcggag
ctcgccgagggccccgccctggcaatggtcgactccgaccgcggcatcaccaacctgcac
gtgcccagcgacgtcatcgtcgacgcctccatgccggccatgatccgtacctccggccac
atgtggggcccggacggccgggaggcggacaccctggcggtcctgcccgactcgagctac
gccggcatctaccaggtcgccatcgacgactgccgggcgcacggcgcctacgaccccgcg
acgatgggctcggtggccaacgtcggcctgatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatccccaccacgggcacggtgcggatcgtcgaccaggccggc
accgtggtgctggagcaggcggtcgccgccggcgacatctttcgcgcctgccagaccaag
gacgcgccgatccgggactgggtgaagctcgccgtcgcgcgcgcccgcgccaccggtgac
ccggcggtgttctggctcgacgagaaccgcgcccacgacgcgaggctgatcgagaaggtc
cgggcgtatctgcccgggcacgacacctccgggctgcggatcgagatcaaggctccggtc
gacgcgatcgcgttctcactggagcggatccgccgcggcgagaacacgatctcagtcacc
ggcaacgtgctgcgtgactatctgaccgacctgttcccgatcctggagctcggcacgagt
gccaagatgctctcgatcgtcccgctcatgaacggtggcggcctgttcgagaccggcgcc
ggcggctccgcgcccaagcacgtccagcagctgctcagggagaactacctgcgctgggac
agcctgggcgagttcctggcgctcgcggccagcttcgagcagttcgcgcggacgacgggc
aacgcgcgtgcccaggtgctcgccgacaccctcgaccgcgcgaccgccaccttcctcaac
gaggacaagtcgcccagccgccggctgggtggcctcgacaaccgcggcagccatttctac
ctggcgctctactgggcgcaggagctggccgcgcagatcggcgacccccgtctcgcggag
gcgttcgccggtctcgccaagacgctcgccgaccaggagaaggcgatcgtcgacgaactg
atcgcggtccagggctcgcctgccgacatcggggggtactaccagcccgaccccgtcaag
gccgcggccgtcatgcgtccgtcgaagatcttcaacgaggccatcgccagcctcggctga

DBGET integrated database retrieval system