KEGG   Frankia casuarinae: Francci3_2452Help
Entry
Francci3_2452     CDS       T00320                                 

Definition
(GenBank) aminotransferase, class I and II
  KO
K16423  (S)-3,5-dihydroxyphenylglycine transaminase [EC:2.6.1.103]
Organism
fra  Frankia casuarinae
Pathway
fra00261  Monobactam biosynthesis
fra01055  Biosynthesis of vancomycin group antibiotics
fra01100  Metabolic pathways
fra01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    Francci3_2452
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Francci3_2452
Enzymes [BR:fra01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.103  (S)-3,5-dihydroxyphenylglycine transaminase
     Francci3_2452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ABD11819
RhizoBase: Francci3_2452
UniProt: Q2JA73
Position
complement(2859542..2860867)
Genome map
AA seq 441 aa AA seqDB search
METTHYPRKEDLRKEDLHSSVADPVMDTMNFLNEVTVRFPTAISFAPGRPYDGFFDIEQI
FTQVRRYLDHLAERGDSPAQIRDALFQYGPSAGQIRKLIAESLRVDEGIDVPPESIVVTV
GCQEAMFLALRALMRDPGDVLVVSSPCYVGITGAARLLDIEVTPVEERADGLHCADLAAA
VAAERARGRRVRAVYVVPDHSNPSGVTMPLPARRALLDLAVRLDLLILEDSPYRLVSPGP
QVPTLKSLDPARRVIHLGSYSKTVFPGARVGFAVADQVVRDASGGTGLLADDLAKIKSMV
TVNTSPLSQAAIAGALLAADGRISELNGETSAYYGDTMRAMLQCLDKHLPAERRAERGVS
WNSPRGGFFLTMRVPFRADNAALTRSAQDFGVIWTPMSYFYPKGGGDHSIRLSTSYLTRF
DIEEGIARLVGFVESQANPPR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggagacaacccattacccgcgcaaggaagacctgcgcaaggaagacctgcactccagc
gtcgccgatcccgtcatggacacgatgaactttctcaacgaggtcaccgtgcgtttcccc
acggcgatctcgttcgctcctggacggccctatgacggcttcttcgacatcgagcagatc
ttcacgcaggtgcggcgttatctcgatcacctggccgagcggggcgactcgccagctcag
atccgcgacgccctgttccagtacggcccgtccgccggacagatccggaagctgatcgcc
gaatcactccgggtggacgagggcatcgacgtgccgccggagtccatcgtggtcacggtc
ggctgccaggaggcgatgttcctggcgctgcgggcgctcatgcgggacccgggcgacgtg
ctggtcgtctccagcccgtgctacgtggggatcaccggcgcggcccggctgttggacatc
gaggtgaccccggtcgaggaacgggcggacgggctgcactgcgccgatctggcggccgcg
gtcgcggccgagcgggcgcgcgggcgccgggtcagggccgtctacgtggtccccgaccac
tccaacccctccggggtgaccatgccgctgccggcccggcgggcgctgctcgacctggcc
gtacgccttgacctgctgatccttgaggacagcccgtaccggctggtcagcccgggcccg
caggtgccgacgctgaagtcgctcgatccggcgcgccgggtgatccacctcggctcctac
tccaagacggtcttcccgggggcccgcgtcggattcgcggtcgccgaccaggtggtgcgg
gacgcctccggagggaccgggctgctggccgacgacctcgccaagatcaagagcatggtc
acggtgaacacctcgccgctcagccaggccgccatcgccggggccctgctcgccgccgac
ggccggatctccgagctgaacggcgagacctcggcctactacggcgacaccatgcgcgcc
atgctgcagtgcctggacaagcacctgccggccgagcggcgggccgagcgcggggtgagc
tggaactcaccccgcggcggattcttcctgaccatgcgggtgccgttccgtgccgacaat
gccgcgctgacccgttcggcgcaggacttcggggttatctggacgccgatgtcctacttc
tatccgaagggcggcggcgaccacagcatccggctgtccaccagctacctgacccgcttc
gacatcgaggagggcatcgcgcggctggtcggcttcgtggagtcgcaggccaacccgccg
cgctga

DBGET integrated database retrieval system