KEGG   Frankia sp. CcI3: Francci3_2486Help
Entry
Francci3_2486     CDS       T00320                                 

Definition
(GenBank) dehydrogenase subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fra  Frankia sp. CcI3
Pathway
fra00010  Glycolysis / Gluconeogenesis
fra00020  Citrate cycle (TCA cycle)
fra00620  Pyruvate metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
fra01130  Biosynthesis of antibiotics
fra01200  Carbon metabolism
Module
fra_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_2486
   00020 Citrate cycle (TCA cycle)
    Francci3_2486
   00620 Pyruvate metabolism
    Francci3_2486
Enzymes [BR:fra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Francci3_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ABD11853
RhizoBase: Francci3_2486
UniProt: Q2JA39
Position
complement(2932143..2933435)
Genome map
AA seq 430 aa AA seqDB search
MAAVREFPLPDLGEGLTSAEVVRWLVGVGDVITVDQPVAEVETAKAVVEVPCPYAGVVTS
LAGLAGTSVPVGTPLITVAVSEPAAGRTGSGNILVGYGTSTEPPRTRRRRRVGAPGAPPV
PALTPTPGPATPLGPSAQTVVKVVSPLVRRFARENSVDLRKLVGTGPDGLILRKDVESAI
APRSAPSRPAETDSTVVPLDPLARRAAETFARSRREVPDATCWVDTDATALLAAKDTLND
TRNAGGAEPRIGLLAILARICVAALVRFPALNSAVVTDADGRATGVRHHAAVHLGFAAQT
PRGLVVPVVHHAQGLTTARLAAEIARLTAAARAGTLTPAELTGGTFTLNNYGVFGVDGST
PIIHHPEAAMIGIGRIVPRPWAVDGELAVRRIVQLSFTFDHRVCDGATAGSFLRFVADAV
EDPTVLLRHL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcggtacgcgaattccccctccccgacctcggcgagggcctgacctccgccgag
gtcgtccgctggcttgtcggcgtcggggacgtcatcaccgtcgaccaacccgtagccgag
gtcgagaccgccaaagccgtcgtcgaggtgccctgcccctacgccggcgtcgtcacctcc
ctcgcgggcctggccggtaccagtgtcccggtcggcacaccactgatcaccgtggccgtc
agcgagccggcagcagggcgaacgggctccgggaacatcctcgtcggttacggcaccagc
acggaacccccccgaacccgccgccgacgacgcgtcggcgctcccggagcgccccccgta
ccggcgctcaccccgactcccggaccggcgacgccactcgggccttccgcccagaccgtg
gtcaaggtcgtctcgcccctcgttcgccgcttcgcccgcgagaactccgtcgatctccga
aaactcgtcggcaccggcccggacgggctgattctgcgcaaggacgtggagagtgccatc
gccccgcgttccgctccgtcgcgcccggcggagaccgactcgaccgtcgtcccgctggac
ccgctggcgcggcgcgcggcggagacgttcgcgcgcagcaggcgcgaggtgccggacgcc
acctgctgggtcgacacggatgccaccgcgctgctcgccgccaaggacaccctcaacgac
acccgcaacgctgggggcgccgagcccagaatcggtctcctggcgatcctggcccgcatc
tgcgtcgccgccctggtccgctttcccgcactcaactccgccgtcgtcaccgacgcggac
ggccgcgcgaccggcgtgcgccaccacgccgccgtccacctgggattcgccgcccagacc
ccgcgcggcctggtcgtgcccgtggtgcaccacgctcagggcctgaccaccgctcgactg
gccgccgagatcgcccggttgaccgccgccgcccgcgcgggcacgctcactcccgccgag
ttgaccggcggcacgttcacgctcaacaactacggcgtcttcggtgtcgacggctccacg
cccatcatccaccaccccgaggccgcgatgatcggcatcggccggatcgtccccaggccc
tgggcggtggacggcgaactggcggtccgcaggatcgtgcagctttcgttcacctttgac
caccgagtctgcgacggcgccaccgccgggtcctttctgcgcttcgtcgccgacgcggtc
gaagaccccacggtgctgctgcgccacctctga

DBGET integrated database retrieval system