KEGG   Frankia casuarinae: Francci3_2805Help
Entry
Francci3_2805     CDS       T00320                                 

Definition
(GenBank) HpcH/HpaI aldolase
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
fra  Frankia casuarinae
Pathway
fra00630  Glyoxylate and dicarboxylate metabolism
fra00660  C5-Branched dibasic acid metabolism
fra00680  Methane metabolism
fra01100  Metabolic pathways
fra01120  Microbial metabolism in diverse environments
fra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Francci3_2805
   00660 C5-Branched dibasic acid metabolism
    Francci3_2805
  09102 Energy metabolism
   00680 Methane metabolism
    Francci3_2805
Enzymes [BR:fra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     Francci3_2805
    4.1.3.25  (S)-citramalyl-CoA lyase
     Francci3_2805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABD12163
RhizoBase: Francci3_2805
UniProt: Q2J979
Position
complement(3303757..3304824)
Genome map
AA seq 355 aa AA seqDB search
MRSAKDFFAPLAVGAPPPPREIPWRPSRMIHFFDPSNEKMAAKLPQIIPRVDVLLGNLED
GVRADNKIVARENLIKIVDGADFGETQFWIRLNSLDSPWGLDDLLTLVPAIGENLDVVMV
PKVQGAEDIHYVDRLLAQLEAKAGLSRPVLVHAILETARGVANVEEICAASPRMQGLSLG
PADLAADRRMKTTRVGGGHPGYLVRQDPRPDDPAAVRATFQQDPWHYTLARMVDACAANG
IMPYYGPFGDIADVLACEDQFRNAFLLGCVGAWSLHPVQIDIAKKVFSPEPADVEWAKRV
VAAMGDGTGAVMVDGTMQDDASVKQCRVILTLATRLAARDAQLAAAYGLPAPEAR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcgccaaggatttcttcgctcccctcgccgtgggggcgccacccccgcctcgc
gagatcccgtggcggccgtcccggatgattcacttcttcgacccgagcaacgagaagatg
gcggcgaagctgccgcagatcatcccccgggtcgacgtgctgctcgggaacctcgaggac
ggggtccgagcggacaacaagatcgttgccagggagaacctgataaagatcgtcgacggc
gcggacttcggtgagacgcagttctggatccgcctgaacagcctcgactcaccctggggg
ctcgacgacctgctcacgctcgtgcccgccatcggcgagaatctcgacgtggtgatggtg
cccaaggtccagggggcggaggacatccactatgtggaccgcctcctcgcccagttggag
gcgaaggccggcctgtcccggccggtgcttgtccacgcgattctggagaccgcgcgaggg
gtcgcgaacgtcgaggagatctgcgcggcaagtccccgcatgcagggtctgtccctcggc
ccggcggacctggcggcggaccggcggatgaagacaacccgtgtcggcggtgggcacccc
ggctacctggtacgccaggatccgcggccggacgacccggcggctgtccgagccacgttc
cagcaggatccctggcactacacgctcgcccggatggtagacgcctgcgcggcgaacggg
atcatgccgtactacgggccgttcggtgacatcgccgacgtcctcgcctgcgaggaccag
ttccgcaacgcgttcctgctcgggtgtgtcggggcgtggtcactgcatcccgttcagatc
gacatcgcgaagaaggtcttcagccccgagcccgcggatgtcgagtgggcaaagcgcgtc
gtcgcggccatgggcgacggaacgggtgccgtgatggtggacggtacgatgcaggacgac
gcctcggtgaagcagtgccgggtcatcctcactctcgccactcgcctcgccgcccgggac
gcgcagctcgcggcggcctacggactacccgcgccggaggcacgatga

DBGET integrated database retrieval system