KEGG   Frankia casuarinae: Francci3_2867Help
Entry
Francci3_2867     CDS       T00320                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
fra  Frankia casuarinae
Pathway
fra00350  Tyrosine metabolism
fra00360  Phenylalanine metabolism
fra00380  Tryptophan metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Francci3_2867
   00360 Phenylalanine metabolism
    Francci3_2867
   00380 Tryptophan metabolism
    Francci3_2867
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fra04147]
    Francci3_2867
Enzymes [BR:fra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     Francci3_2867
    4.1.1.105  L-tryptophan decarboxylase
     Francci3_2867
Exosome [BR:fra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Francci3_2867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABD12225
RhizoBase: Francci3_2867
UniProt: Q2J917
Position
3380103..3381692
Genome map
AA seq 529 aa AA seqDB search
MRGMPPVDALRAALRAAAGHADAYLAGLADRRVGPSLTAEQVRRRLGDTLPAGPSDPVAV
IDALVDAVAGGLTATGSGRFFGYVVGGTLPAALAADLLTVVWDQNAALASLSPAASAVEA
LTGRWIAQLLGLPSGVSVGFTTGTQMAHVTALAAARHRVLARAGWDVETDGLAGAPPVRV
LVGAARHATVDAALRLLGFGTRATIAVEADELGRMRPEALRAALADESGGSGPTIVIAQA
GEVNTGGFDPFEEVCALAREHGAWVHVDGAFGLWAAVSAAASRRALVAGVERADSWATDG
HKWLNVPYDCGIALIADREAHRRSMSVSADYFVLDSAGRLDPVDWTPEFSRRARAFAVYA
ALRSLGRAGLRDLVDRCCEYANRFAVRLAALPGVTVLNSVAGPAGSAGSAGPGRVVELNQ
VLIRVVADQEGDRTAAGRAEGDRLTAAVTAAVTASGEAFVSGTVWRGRTAMRISVSNWST
SDGEVERTIAVIEAAVAEARGTTVRGTTVRGTTVAAPSGGGTHRGGIAS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggcatgccgcccgttgacgcgctccgcgcggcactgcgcgccgccgccgggcat
gccgacgcctacctggcgggtctggccgatcgtcgggtcggccccagcctgaccgccgag
caggtccgccgccggctcggcgacacgctgccggcaggcccgagcgacccggtggcggtc
atcgacgccctggtcgacgcggtggccggcggcctcaccgcgaccggctcgggccgcttc
ttcggctacgtcgtcggcgggaccctgccggcggcgctcgccgccgacctgctcaccgtc
gtgtgggaccagaacgccgccctggcctccctctccccggccgccagcgccgtcgaggcg
ctgaccggccgctggatcgcgcaactgctcggcctgccgtcgggggtgtccgtcgggttc
accaccggcacccagatggcgcacgtgaccgccctggcggccgcacggcaccgggtgctg
gcgcgggccggctgggatgtcgagacggacggtctcgccggggcgccgcccgtgcgggtc
ctggtcggtgccgcccggcacgccaccgtcgacgccgcgttgcgcctgctcggattcggc
acccgcgcgacgatcgccgtcgaggccgacgaactcgggcggatgcgccccgaggcgctg
cgggcggcccttgccgacgagagcggcgggagcgggccgacgatcgtgatcgcccaggcg
ggggaggtcaacaccggcgggttcgaccccttcgaggaggtgtgcgcgctggcccgcgaa
cacggcgcctgggtacacgtggacggtgcgttcgggctgtgggcggcggtgtcggcggcg
gcgtcccggcgcgccctcgtcgccggggtcgagcgggccgactcgtgggcgaccgacggc
cacaagtggctcaacgtcccgtacgactgcgggatcgcgctcatcgcggaccgcgaggcg
caccggcggtcgatgtcggtctcggcggattacttcgtcctcgactccgccggccggctc
gacccggtcgactggacaccggagttcagccgccgggcacgggccttcgccgtatacgcg
gcgctgcgctcgctcggccgggcggggctgcgcgatctggtggaccggtgctgcgagtat
gccaaccgcttcgccgtgcggctcgccgctcttcccggggtgacggtgctgaactcggtg
gccggcccagccgggtcagccgggtcagccggcccgggccgcgtcgtggagctcaaccag
gtgctgatccgggtggtggcagaccaggagggcgaccggacggcggccgggcgggcggag
ggcgaccggctgacggcggcggtcacggccgcggtgacggcgagcggcgaggcgttcgtg
agcggcacggtgtggcgggggcgcacggcgatgcgcatctcggtaagcaactggtcgacc
tcggacggcgaggtggagcggacgatcgcggtgatcgaggccgccgtcgccgaggcgcgg
gggacgaccgtgcgggggacgaccgtgcgggggacgaccgtggcggcgccgagcggcggc
ggtacgcaccgcggcggtatcgcttcgtag

DBGET integrated database retrieval system