KEGG   Frankia sp. CcI3: Francci3_3202Help
Entry
Francci3_3202     CDS       T00320                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
fra  Frankia sp. CcI3
Pathway
fra00240  Pyrimidine metabolism
fra00250  Alanine, aspartate and glutamate metabolism
fra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Francci3_3202
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Francci3_3202
Enzymes [BR:fra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Francci3_3202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABD12559
RhizoBase: Francci3_3202
UniProt: Q2J833
Position
complement(3795822..3796778)
Genome map
AA seq 318 aa AA seqDB search
MGSTSRVRGTGVNRHLLSTEDLDRDDALLVLDTAERMARVAEASVRKLPTLRGRTVVNLF
FEDSTRTRTSFEVAAKRLSADVINFSARGSSVSKGESLKDTAQTLEAMGADAVVCRHAAS
GAPHRLASWVRGSVVNAGDGTHEHPTQALLDAFTMRRRLGRIDGLAVTIVGDVLHSRVAR
SNVWLLATLGATVTVVAPPTLVPLGISSWPVEVSYNLDAVLPKSDVVMMLRVQRERMSAA
FFPTEREYSRRYGLDADRAEMLPDHALVMHPGPMVRGMEIASRVADSARSTVVEQVANGV
SVRMAVLYLLLGGSGEVS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggggagcacaagccgggttcgggggacgggcgtgaaccgccatctcctgtcgactgag
gatctcgaccgggacgacgcgctgctggtgctggacaccgccgaacggatggcgcgggtc
gccgaggcgtcggtgcgcaaactgccgaccctgcggggccgcaccgtcgtcaacctgttc
ttcgaggactccacccgcacccgtacgtccttcgaggtagccgccaagagactgtcggcc
gatgtgatcaatttttcggcgcgcgggtcaagcgtgtcgaagggcgaaagtctgaaggac
acggcgcagacccttgaggcgatgggtgccgacgccgtggtctgccggcatgccgcgagt
ggcgcgccgcaccgactggcctcctgggtacgcggcagcgtggtgaacgcgggagacggc
actcacgagcacccgacccaggccctgctcgacgccttcaccatgcgccgccggctcggc
cggatcgacggcctcgccgtcaccatcgtcggcgacgtgctgcattcccgggtggcgcga
tcgaacgtgtggctgctcgccacgctgggcgcgacggtgaccgtcgtggccccgccgacg
ttggtgcccctcggaatctcctcgtggccggtcgaggtgtcgtacaacctcgacgccgtg
ctgcccaagagcgacgtggtgatgatgctgcgggtccagcgggagcggatgtccgcggcc
ttcttcccgaccgaacgggagtacagccggcgctacgggctggatgccgaccgggcggag
atgttgcccgaccacgccctggtgatgcatcccggcccgatggtacgcgggatggagatc
gcctctcgggtcgccgactccgcccggtcgacagtcgtggaacaggttgcgaacggggtg
agcgtgcggatggccgtgctgtacctgctgctgggtggttccggggaggtctcatga

DBGET integrated database retrieval system